2R7E: Coagulation factor VIII

Crystal Structure Analysis of Coagulation Factor VIII. Determined by X-ray diffraction at 3.7 Å resolution. Released 15 Apr 2008.

Method: X-ray diffraction
Resolution: 3.7 Å
Organism: Homo sapiens
Chains: 2
Atoms: 10,985
Mol. weight: 176.52 kDa
Ligands: CA, CU
Released: 15 Apr 2008

Explore 2R7E in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2R7E contains 12 α-helices and 110 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 8 helices, 55 β-strands

Element	Residues	Length	Sheet
β-strand	4	1	1
β-strand	13-14	2	2
β-strand	46-47	2	2
β-strand	73-78	6	3
β-strand	81-85	5	1
β-strand	88-89	2	4
β-strand	133-134	2	4
β-strand	137-140	4	1
α-helix	142-144	3
β-strand	156-158	3	3
α-helix	165-171	7
β-strand	174-178	5	3
β-strand	194-195	2	5
β-strand	199-200	2	6
β-strand	233-234	2	6
β-strand	237	1	6
β-strand	240	1	7
β-strand	246-247	2	8
β-strand	253-256	4	5
β-strand	277-278	2	9
β-strand	281-282	2	9
β-strand	295-298	4	5
β-strand	305-306	2	8
β-strand	322	1	7
β-strand	324-326	3	8
β-strand	381-383	3	10
β-strand	386-387	2	11
β-strand	390-394	5	12
β-strand	415	1	13
β-strand	418	1	13
β-strand	422-426	5	12
β-strand	429	1	11
β-strand	434	1	14
β-strand	437	1	14
β-strand	456	1	15
β-strand	460-462	3	10
β-strand	465-466	2	11
β-strand	473	1	16
β-strand	476-477	2	17
β-strand	482-483	2	10
β-strand	504	1	16
β-strand	508-509	2	11
β-strand	512-514	3	10
β-strand	532-534	3	17
α-helix	543-545	3
β-strand	549-550	2	17
β-strand	554	1	15
β-strand	573-576	4	18
β-strand	578	1	19
α-helix	581-583	3
α-helix	588-594	7
α-helix	606-609	4
α-helix	610-612	3
β-strand	615	1	19
β-strand	636-637	2	20
β-strand	638-641	4	18
β-strand	652-653	2	21
β-strand	661	1	20
β-strand	665	1	20
β-strand	676-677	2	18
β-strand	680-681	2	20
β-strand	691-692	2	21
α-helix	699-702	4

Chain B: 4 helices, 55 β-strands

Element	Residues	Length	Sheet
β-strand	1696-1704	9	22
β-strand	1733-1737	5	22
β-strand	1771-1776	6	22
β-strand	1787	1	23
β-strand	1812-1816	5	22
β-strand	1832-1837	6	23
α-helix	1845-1848	4
β-strand	1853-1858	6	23
β-strand	1874-1877	4	24
β-strand	1882-1883	2	25
α-helix	1893-1895	3
β-strand	1918-1919	2	25
β-strand	1940-1943	4	24
β-strand	1955-1957	3	26
β-strand	1958	1	27
β-strand	1963-1964	2	28
β-strand	1972-1973	2	28
β-strand	1975-1977	3	26
β-strand	1985-1986	2	24
β-strand	1987-1988	2	28
β-strand	1994	1	29
β-strand	1998	1	27
α-helix	2003-2006	4
β-strand	2009	1	25
β-strand	2016	1	29
β-strand	2024	1	30
β-strand	2062-2063	2	31
β-strand	2071-2081	11	32
β-strand	2083	1	30
β-strand	2089-2090	2	33
β-strand	2095-2096	2	33
β-strand	2100-2106	7	32
β-strand	2113	1	32
β-strand	2144-2155	12	32
β-strand	2161-2162	2	31
β-strand	2167	1	30
β-strand	2192	1	34
β-strand	2197	1	35
β-strand	2202	1	35
α-helix	2205-2207	3
β-strand	2209	1	36
β-strand	2219	1	37
β-strand	2230-2232	3	34
β-strand	2240	1	38
β-strand	2243-2245	3	36
β-strand	2259-2262	4	34
β-strand	2265	1	39
β-strand	2271	1	39
β-strand	2275	1	40
β-strand	2280	1	40
β-strand	2283-2284	2	34
β-strand	2293-2295	3	36
β-strand	2305	1	39
β-strand	2306-2310	5	34
β-strand	2314	1	41
β-strand	2316	1	41
β-strand	2319	1	37
β-strand	2321-2322	2	36
β-strand	2325	1	38

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Coagulation factor VIII	A	protein	742	Homo sapiens	P00451 (AlphaFold model)
Coagulation factor VIII	B	protein	770	Homo sapiens	P00451 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2R7E_1 Coagulation factor VIII (chains A)
SATRRYYLGAVELSWDYMQSDLGELPVDARFPPRVPKSFPFNTSVVYKKTLFVEFTDHLF
NIAKPRPPWMGLLGPTIQAEVYDTVVITLKNMASHPVSLHAVGVSYWKASEGAEYDDQTS
QREKEDDKVFPGGSHTYVWQVLKENGPMASDPLCLTYSYLSHVDLVKDLNSGLIGALLVC
REGSLAKEKTQTLHKFILLFAVFDEGKSWHSETKNSLMQDRDAASARAWPKMHTVNGYVN
RSLPGLIGCHRKSVYWHVIGMGTTPEVHSIFLEGHTFLVRNHRQASLEISPITFLTAQTL
LMDLGQFLLFCHISSHQHDGMEAYVKVDSCPEEPQLRMKNNEEAEDYDDDLTDSEMDVVR
FDDDNSPSFIQIRSVAKKHPKTWVHYIAAEEEDWDYAPLVLAPDDRSYKSQYLNNGPQRI
GRKYKKVRFMAYTDETFKTREAIQHESGILGPLLYGEVGDTLLIIFKNQASRPYNIYPHG
ITDVRPLYSRRLPKGVKHLKDFPILPGEIFKYKWTVTVEDGPTKSDPRCLTRYYSSFVNM
ERDLASGLIGPLLICYKESVDQRGNQIMSDKRNVILFSVFDENRSWYLTENIQRFLPNPA
GVQLEDPEFQASNIMHSINGYVFDSLQLSVCLHEVAYWYILSIGAQTDFLSVFFSGYTFK
HKMVYEDTLTLFPFSGETVFMSMENPGLWILGCHNSDFRNRGMTALLKVSSCDKNTGDYY
EDSYEDISAYLLSKNNAIEPRS

Sequence of entity 2 (B), FASTA

>2R7E_2 Coagulation factor VIII (chains B)
DPLAWDNHYGTQIPKEEWKSQEKSPEKTAFKKKDTILSLNACESNHAIAAINEGQNKPEI
EVTWAKQGRTERLCSQNPPVLKRHQREITRTTLQSDQEEIDYDDTISVEMKKEDFDIYDE
DENQSPRSFQKKTRHYFIAAVERLWDYGMSSSPHVLRNRAQSGSVPQFKKVVFQEFTDGS
FTQPLYRGELNEHLGLLGPYIRAEVEDNIMVTFRNQASRPYSFYSSLISYEEDQRQGAEP
RKNFVKPNETKTYFWKVQHHMAPTKDEFDCKAWAYSSDVDLEKDVHSGLIGPLLVCHTNT
LNPAHGRQVTVQEFALFFTIFDETKSWYFTENMERNCRAPCNIQMEDPTFKENYRFHAIN
GYIMDTLPGLVMAQDQRIRWYLLSMGSNENIHSIHFSGHVFTVRKKEEYKMALYNLYPGV
FETVEMLPSKAGIWRVECLIGEHLHAGMSTLFLVYSNKCQTPLGMASGHIRDFQITASGQ
YGQWAPKLARLHYSGSINAWSTKEPFSWIKVDLLAPMIIHGIKTQGARQKFSSLYISQFI
IMYSLDGKKWQTYRGNSTGTLMVFFGNVDSSGIKHNIFNPPIIARYIRLHPTHYSIRSTL
RMELMGCDLNSCSMPLGMESKAISDAQITASSYFTNMFATWSPSKARLHLQGRSNAWRPQ
VNNPKEWLQVDFQKTMKVTGVTTQGVKSLLTSMYVKEFLISSSQDGHQWTLFFQNGKVKV
FQGNQDSFTPVVNSLDPPLLTRYLRIHPQSWVHQIALRMEVLGCEAQDLY

Ligands and cofactors

ID	Name	Formula	Copies
CA	Calcium ion	Ca	3
CU	Copper (II) ion	Cu	2

Primary citation

The tertiary structure and domain organization of coagulation factor VIII. Shen, B.W., Spiegel, P.C., Chang, C.H. et al. Blood (2008) 111:1240-1247. DOI 10.1182/blood-2007-08-109918 · PubMed

Other PDB entries of the same protein (UniProt P00451 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3HNY 1.07 Å, Factor VIII Trp2313-His2315 segment is involved in membrane binding as shown by crystal…
3HNB 1.15 Å, Factor VIII Trp2313-His2315 segment is involved in membrane binding as shown by crystal…
1D7P 1.5 Å, Crystal structure of the c2 domain of human factor viii at 1.5 a resolution at 1.5 A
9D5D 1.83 Å, Crystal Structure of Blood Coagulation Factor VIII C2 Domain Mutant L2251A/L2252A
1IQD 2.0 Å, Human Factor VIII C2 Domain complexed to human monoclonal BO2C11 Fab.
3HOB 2.07 Å, Factor VIII Trp2313-His2315 segment is involved in membrane binding as shown by crystal…
4PT6 2.1 Å, The discobody: an engineered discoidin domain from factor VIII that binds v 3 integrin…
4KI5 2.47 Å, Cystal structure of human factor VIII C2 domain in a ternary complex with murine…
4XZU 2.61 Å, Crystal Structure of the Human Factor VIII C2 Domain in Complex with Murine 3E6…
7KWO 2.9 Å, Rfviiifc-vwf-xten (BIVV001)
36JL 3.15 Å, Coagulation factor VIII, full-length, membrane-bound, on Ptd-choline : Ptd-serine 75:25…
9JBV 3.17 Å, Structure of Engineered Coagulation Factor VIII with Enhanced Secretion and Coagulation…

Browse more

2R7E is part of these collections:

Blood clotting

About this viewer

MolViewer shows 2R7E directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.