2RAI: Sorting nexin-9

The PX-BAR membrane remodeling unit of Sorting Nexin 9. Determined by X-ray diffraction at 3.2 Å resolution. Released 11 Dec 2007.

Method: X-ray diffraction
Resolution: 3.2 Å
Organism: Homo sapiens
Chains: 2
Atoms: 5,919
Mol. weight: 91.91 kDa
Released: 11 Dec 2007

Explore 2RAI in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2RAI contains 31 α-helices and 12 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 16 helices, 6 β-strands

Element	Residues	Length	Sheet
α-helix	216-220	5
β-strand	232-237	6	1
β-strand	240-243	4	1
β-strand	252-255	4	2
β-strand	272-276	5	2
β-strand	283-285	3	2
α-helix	287-301	15
α-helix	308-310	3
α-helix	322-339	18
α-helix	344-346	3
α-helix	348-354	7
α-helix	359-370	12
α-helix	376-382	7
β-strand	383-386	4	1
α-helix	392-428	37
α-helix	430-450	21
α-helix	457-479	23
α-helix	482-484	3
α-helix	486-501	16
α-helix	503-518	16
α-helix	520-525	6
α-helix	531-590	60

Chain B: 15 helices, 6 β-strands

Element	Residues	Length	Sheet
α-helix	216-221	6
β-strand	232-236	5	3
β-strand	241-243	3	3
β-strand	252-255	4	4
β-strand	271-276	6	4
β-strand	283-286	4	4
α-helix	287-301	15
α-helix	323-340	18
α-helix	348-354	7
α-helix	359-368	10
α-helix	376-378	3
α-helix	379-382	4
β-strand	383-385	3	3
α-helix	392-428	37
α-helix	430-449	20
α-helix	457-479	23
α-helix	482-484	3
α-helix	486-500	15
α-helix	503-518	16
α-helix	520-525	6
α-helix	531-590	60

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Sorting nexin-9	A, B	protein	392	Homo sapiens	Q9Y5X1 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>2RAI_1 Sorting nexin-9 (chains A, B)
PLNKFPGFAKPGTEQYLLAKQLAKPKEKIPIIVGDYGPMWVYPTSTFDCVVADPRKGSKM
YGLKSYIEYQLTPTNTNRSVNHRYKHFDWLYERLLVKFGSAIPIPSLPDKQVTGRFEEEF
IKMRMERLQAWMTRMCRHPVISESEVFQQFLNFRDEKEWKTGKRKAERDELAGVMIFSTM
EPEAPDLDLVEIEQKCEAVGKFTKAMDDGVKELLTVGQEHWKRCTGPLPKEYQKIGKALQ
SLATVFSSSGYQGETDLNDAITEAGKTYEEIASLVAEQPKKDLHFLMECNHEYKGFLGCF
PDIIGTHKGAIEKVKESDKLVATSKITLQDKQNMVKRVSIMSYALQAEMNHFHSNRIYDY
NSVIRLYLEQQVQFYETIAEKLRQALSRFPVM

Primary citation

The PX-BAR membrane-remodeling unit of sorting nexin 9. Pylypenko, O., Lundmark, R., Rasmuson, E. et al. EMBO J (2007) 26:4788-4800. DOI 10.1038/sj.emboj.7601889 · PubMed

Other PDB entries of the same protein (UniProt Q9Y5X1 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3DYT 2.08 Å, Crystal structure of Snx9PX-BAR (230-595), C2221
3LGE 2.2 Å, Crystal structure of rabbit muscle aldolase-SNX9 LC4 complex
2RAJ 2.45 Å, SO4 bound PX-BAR membrane remodeling unit of Sorting Nexin 9
2RAK 3.0 Å, PI(3)P bound PX-BAR membrane remodeling unit of Sorting Nexin 9
3DYU 4.1 Å, Crystal structure of Snx9PX-BAR (230-595), H32
7OJ9 NMR solution structure of SNX9 SH3 - EEEV nsP3 peptide complex
9R4W Solution NMR structure of SNX9 SH3 in complex with EspF

Browse structure collections

About this viewer

MolViewer shows 2RAI directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.