3DYU: Snx9PX-BAR (230-595), H32

Crystal structure of Snx9PX-BAR (230-595), H32. Determined by X-ray diffraction at 4.1 Å resolution. Released 16 Sept 2008.

Method: X-ray diffraction
Resolution: 4.1 Å
Organism: Homo sapiens
Chains: 3
Atoms: 8,931
Mol. weight: 127.27 kDa
Released: 16 Sept 2008

Explore 3DYU in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3DYU contains 42 α-helices and 22 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 15 helices, 6 β-strands

Element	Residues	Length	Sheet
β-strand	232-235	4	1
β-strand	242-243	2	1
β-strand	252-259	8	2
β-strand	270-276	7	2
β-strand	283-286	4	2
α-helix	287-301	15
α-helix	309-312	4
α-helix	321-339	19
α-helix	348-354	7
α-helix	361-370	10
α-helix	376-382	7
β-strand	383-385	3	1
α-helix	392-427	36
α-helix	430-449	20
α-helix	459-479	21
α-helix	482-484	3
α-helix	486-501	16
α-helix	505-507	3
α-helix	510-516	7
α-helix	519-525	7
α-helix	531-589	59

Chain B: 14 helices, 6 β-strands

Element	Residues	Length	Sheet
β-strand	232-235	4	3
β-strand	242-243	2	3
β-strand	252-259	8	4
β-strand	270-276	7	4
β-strand	283-286	4	4
α-helix	287-301	15
α-helix	309-312	4
α-helix	321-339	19
α-helix	348-354	7
α-helix	361-370	10
α-helix	376-382	7
β-strand	383-385	3	3
α-helix	392-427	36
α-helix	430-449	20
α-helix	459-479	21
α-helix	482-484	3
α-helix	486-501	16
α-helix	503-516	14
α-helix	519-525	7
α-helix	531-589	59

Chain C: 13 helices, 10 β-strands

Element	Residues	Length	Sheet
β-strand	232-235	4	5
β-strand	242-243	2	5
β-strand	252-254	3	6
β-strand	259	1	7
β-strand	270	1	7
β-strand	271	1	8
β-strand	274-276	3	6
β-strand	283	1	6
β-strand	286	1	8
α-helix	287-301	15
α-helix	321-339	19
α-helix	348-354	7
α-helix	361-370	10
α-helix	376-382	7
β-strand	383-385	3	5
α-helix	392-427	36
α-helix	430-449	20
α-helix	459-479	21
α-helix	482-484	3
α-helix	486-501	16
α-helix	503-516	14
α-helix	519-525	7
α-helix	531-589	59

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Sorting nexin-9	A, B, C	protein	366	Homo sapiens	Q9Y5X1 (AlphaFold model)

Sequence of entity 1 (A, B, C), FASTA

>3DYU_1 Sorting nexin-9 (chains A, B, C)
EKIPIIVGDYGPMWVYPTSTFDCVVADPRKGSKMYGLKSYIEYQLTPTNTNRSVNHRYKH
FDWLYERLLVKFGSAIPIPSLPDKQVTGRFEEEFIKMRMERLQAWMTRMCRHPVISESEV
FQQFLNFRDEKEWKTGKRKAERDELAGVMIFSTMEPEAPDLDLVEIEQKCEAVGKFTKAM
DDGVKELLTVGQEHWKRCTGPLPKEYQKIGKALQSLATVFSSSGYQGETDLNDAITEAGK
TYEEIASLVAEQPKKDLHFLMECNHEYKGFLGCFPDIIGTHKGAIEKVKESDKLVATSKI
TLQDKQNMVKRVSIMSYALQAEMNHFHSNRIYDYNSVIRLYLEQQVQFYETIAEKLRQAL
SRFPVM

Primary citation

Structure and plasticity of endophilin and sorting nexin 9. Wang, Q., Kaan, H.Y., Hooda, R.N. et al. Structure (2008) 16:1574-1587. DOI 10.1016/j.str.2008.07.016 · PubMed

Other PDB entries of the same protein (UniProt Q9Y5X1 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3DYT 2.08 Å, Crystal structure of Snx9PX-BAR (230-595), C2221
3LGE 2.2 Å, Crystal structure of rabbit muscle aldolase-SNX9 LC4 complex
2RAJ 2.45 Å, SO4 bound PX-BAR membrane remodeling unit of Sorting Nexin 9
2RAK 3.0 Å, PI(3)P bound PX-BAR membrane remodeling unit of Sorting Nexin 9
2RAI 3.2 Å, The PX-BAR membrane remodeling unit of Sorting Nexin 9
7OJ9 NMR solution structure of SNX9 SH3 - EEEV nsP3 peptide complex
9R4W Solution NMR structure of SNX9 SH3 in complex with EspF

Browse structure collections

About this viewer

MolViewer shows 3DYU directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.