3DYT: Snx9PX-BAR (230-595), C2221

Crystal structure of Snx9PX-BAR (230-595), C2221. Determined by X-ray diffraction at 2.08 Å resolution. Released 16 Sept 2008.

Method: X-ray diffraction
Resolution: 2.08 Å
Organism: Homo sapiens
Chains: 1
Atoms: 3,032
Mol. weight: 43.18 kDa
Released: 16 Sept 2008

Explore 3DYT in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3DYT contains 19 α-helices and 6 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 19 helices, 6 β-strands

Element	Residues	Length	Sheet
β-strand	232-238	7	1
β-strand	240-243	4	1
β-strand	252-255	4	2
α-helix	257-259	3
β-strand	271-276	6	2
β-strand	283-286	4	2
α-helix	287-301	15
α-helix	306-310	5
α-helix	324-339	16
α-helix	344-346	3
α-helix	348-355	8
α-helix	359-370	12
α-helix	376-382	7
β-strand	383-385	3	1
α-helix	388-391	4
α-helix	392-428	37
α-helix	430-450	21
α-helix	455-457	3
α-helix	458-480	23
α-helix	482-484	3
α-helix	486-500	15
α-helix	503-518	16
α-helix	520-525	6
α-helix	531-590	60
α-helix	593-594	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Sorting nexin-9	A	protein	366	Homo sapiens	Q9Y5X1 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>3DYT_1 Sorting nexin-9 (chains A)
EKIPIIVGDYGPMWVYPTSTFDCVVADPRKGSKMYGLKSYIEYQLTPTNTNRSVNHRYKH
FDWLYERLLVKFGSAIPIPSLPDKQVTGRFEEEFIKMRMERLQAWMTRMCRHPVISESEV
FQQFLNFRDEKEWKTGKRKAERDELAGVMIFSTMEPEAPDLDLVEIEQKCEAVGKFTKAM
DDGVKELLTVGQEHWKRCTGPLPKEYQKIGKALQSLATVFSSSGYQGETDLNDAITEAGK
TYEEIASLVAEQPKKDLHFLMECNHEYKGFLGCFPDIIGTHKGAIEKVKESDKLVATSKI
TLQDKQNMVKRVSIMSYALQAEMNHFHSNRIYDYNSVIRLYLEQQVQFYETIAEKLRQAL
SRFPVM

Primary citation

Structure and plasticity of endophilin and sorting nexin 9. Wang, Q., Kaan, H.Y., Hooda, R.N. et al. Structure (2008) 16:1574-1587. DOI 10.1016/j.str.2008.07.016 · PubMed

Other PDB entries of the same protein (UniProt Q9Y5X1 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3LGE 2.2 Å, Crystal structure of rabbit muscle aldolase-SNX9 LC4 complex
2RAJ 2.45 Å, SO4 bound PX-BAR membrane remodeling unit of Sorting Nexin 9
2RAK 3.0 Å, PI(3)P bound PX-BAR membrane remodeling unit of Sorting Nexin 9
2RAI 3.2 Å, The PX-BAR membrane remodeling unit of Sorting Nexin 9
3DYU 4.1 Å, Crystal structure of Snx9PX-BAR (230-595), H32
7OJ9 NMR solution structure of SNX9 SH3 - EEEV nsP3 peptide complex
9R4W Solution NMR structure of SNX9 SH3 in complex with EspF

Browse structure collections

About this viewer

MolViewer shows 3DYT directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.