2RKZ: Second and third fibronectin f1 modules

Crystal structure of the second and third fibronectin f1 modules in complex with a fragment of staphylococcus aureus fnbpa-1. Determined by X-ray diffraction at 2.0 Å resolution. Released 5 Aug 2008.

Method: X-ray diffraction
Resolution: 2.0 Å
Organisms: Homo sapiens, Staphylococcus aureus (strain NCTC 8325)
Chains: 12
Atoms: 5,928
Mol. weight: 75.83 kDa
Ligands: SIN
Released: 5 Aug 2008

Explore 2RKZ in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2RKZ contains 0 α-helices and 73 β-strands across 12 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A and C: 0 helices, 10 β-strands

Element	Residues	Length	Sheet
β-strand	65-68	4	1
β-strand	73-76	4	1
β-strand	80-85	6	2
β-strand	88-96	9	2
β-strand	101-105	5	2
β-strand	109-112	4	3
β-strand	115-118	4	3
β-strand	122-126	5	4
β-strand	133-140	8	4
β-strand	145-150	6	4

Chains B and F: 0 helices, 10 β-strands

Element	Residues	Length	Sheet
β-strand	65-67	3	5
β-strand	74-76	3	5
β-strand	80-85	6	6
β-strand	88-96	9	6
β-strand	101-105	5	6
β-strand	109-112	4	7
β-strand	115-118	4	7
β-strand	122-126	5	8
β-strand	133-140	8	8
β-strand	145-150	6	8

Chain D: 0 helices, 11 β-strands

Element	Residues	Length	Sheet
β-strand	63-64	2	3
β-strand	65-68	4	13
β-strand	73-76	4	13
β-strand	80-85	6	10
β-strand	88-96	9	10
β-strand	101-105	5	10
β-strand	109-112	4	14
β-strand	115-118	4	14
β-strand	122-126	5	15
β-strand	133-140	8	15
β-strand	145-150	6	15

Chain E: 0 helices, 10 β-strands

Element	Residues	Length	Sheet
β-strand	65-68	4	16
β-strand	73-76	4	16
β-strand	80-85	6	17
β-strand	88-96	9	17
β-strand	101-105	5	17
β-strand	109-112	4	18
β-strand	115-118	4	18
β-strand	122-124	3	19
β-strand	135-140	6	19
β-strand	145-149	5	19

Chains M and N: 0 helices, 2 β-strands

Element	Residues	Length	Sheet
β-strand	531-533	3	4
β-strand	542-545	4	2

Chains O, P, Q and R: 0 helices, 2 β-strands

Element	Residues	Length	Sheet
β-strand	531-533	3	12
β-strand	542-546	5	10

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Fibronectin	A, B, C, D, E, F	protein	90	Homo sapiens	P02751 (AlphaFold model)
peptide from Fibronectin-binding protein A	M, N, O, P, Q, R	protein	23	Staphylococcus aureus (strain NCTC 8325)	P14738 (AlphaFold model)

Sequence of entity 1 (A, B, C, D, E, F), FASTA

>2RKZ_1 Fibronectin (chains A, B, C, D, E, F)
AEETCFDKYTGNTYRVGDTYERPKDSMIWDCTCIGAGRGRISCTIANRCHEGGQSYKIGD
TWRRPHETGGYMLECVCLGNGKGEWTCKPI

Sequence of entity 2 (M, N, O, P, Q, R), FASTA

>2RKZ_2 peptide from Fibronectin-binding protein A (chains M, N, O, P, Q, R)
XETLTGQYDKNLVTTVEEEYDSX

Ligands and cofactors

ID	Name	Formula	Copies
SIN	Succinic acid	C4 H6 O4	3

Primary citation

Crystal structures of fibronectin-binding sites from Staphylococcus aureus FnBPA in complex with fibronectin domains. Bingham, R.J., Meenan, N.A., Schwarz-Linek, U. et al. Proc Natl Acad Sci U S A (2008) 105:12254-12258. DOI 10.1073/pnas.0803556105 · PubMed

Other PDB entries of the same protein (UniProt P02751 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2CG7 1.2 Å, Second and third fibronectin type I module pair (crystal form II).
4LXO 1.42 Å, Crystal structure of 9,10Fn3-elegantin chimera
5DC4 1.48 Å, Crystal structure of monobody AS25/ABL1 SH2 domain complex, crystal a
2CG6 1.55 Å, Second and third fibronectin type I module pair (crystal form I).
5DC9 1.56 Å, Crystal structure of monobody AS25/ABL1 SH2 domain complex, crystal B
5N48 1.6 Å, Structure of Anticalin N9B in complex with extra-domain B of human oncofetal fibronectin
3CAL 1.7 Å, Crystal structure of the second and third fibronectin F1 modules in complex with a…
3ZRZ 1.7 Å, Crystal structure of the second and third fibronectin F1 modules in complex with a…
6MFA 1.75 Å, Fragment of human fibronectin containing the 4th-7th type III domains
1FNA 1.8 Å, Crystal structure of the tenth type III cell adhesion module of human fibronectin
2RKY 1.8 Å, Crystal structure of the fourth and fifth fibronectin F1 modules in complex with a…
4PZ5 1.96 Å, Crystal structure of the second and third fibronectin F1 modules in complex with a…

Browse structure collections

About this viewer

MolViewer shows 2RKZ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.