2RL0: Fourth and fifth fibronectin F1 modules

Crystal structure of the fourth and fifth fibronectin F1 modules in complex with a fragment of staphylococcus aureus fnbpa-5. Determined by X-ray diffraction at 2.0 Å resolution. Released 5 Aug 2008.

Method: X-ray diffraction
Resolution: 2.0 Å
Organisms: Homo sapiens, synthetic construct
Chains: 12
Atoms: 5,338
Mol. weight: 72.91 kDa
Released: 5 Aug 2008

Explore 2RL0 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2RL0 contains 3 α-helices and 69 β-strands across 12 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A and B: 1 helix, 10 β-strands

Element	Residues	Length	Sheet
β-strand	154-157	4	1
β-strand	162-165	4	1
β-strand	169-174	6	2
β-strand	178-186	9	2
β-strand	191-195	5	2
β-strand	199-202	4	3
β-strand	207-210	4	3
β-strand	214-218	5	2
α-helix	223	1
β-strand	224-231	8	2
β-strand	236-240	5	2

Chain C: 0 helices, 2 β-strands

Element	Residues	Length	Sheet
β-strand	640-647	8	2
β-strand	648-651	4	5

Chain D: 1 helix, 10 β-strands

Element	Residues	Length	Sheet
β-strand	154-157	4	7
β-strand	162-165	4	7
β-strand	169-174	6	8
β-strand	178-186	9	8
β-strand	191-195	5	8
β-strand	200-202	3	9
β-strand	207-209	3	9
β-strand	214-218	5	10
α-helix	223	1
β-strand	224-231	8	10
β-strand	236-240	5	10

Chain E: 0 helices, 2 β-strands

Element	Residues	Length	Sheet
β-strand	640-644	5	10
β-strand	648-652	5	8

Chains F and K: 0 helices, 10 β-strands

Element	Residues	Length	Sheet
β-strand	154-157	4	11
β-strand	162-165	4	11
β-strand	169-174	6	2
β-strand	178-186	9	2
β-strand	191-195	5	2
β-strand	199-202	4	12
β-strand	207-210	4	12
β-strand	214-218	5	2
β-strand	224-231	8	2
β-strand	236-240	5	2

Chains G and H: 0 helices, 1 β-strand

Element	Residues	Length	Sheet
β-strand	640-651	12	2

Chain I: 0 helices, 10 β-strands

Element	Residues	Length	Sheet
β-strand	154-157	4	13
β-strand	162-165	4	13
β-strand	169-174	6	2
β-strand	178-186	9	2
β-strand	191-195	5	2
β-strand	199-202	4	14
β-strand	207-210	4	14
β-strand	214-215	2	2
β-strand	227-231	5	2
β-strand	236-239	4	2

Chain J: 0 helices, 1 β-strand

Element	Residues	Length	Sheet
β-strand	641-651	11	2

1 more chain groups are not listed. Open the entry in the viewer and use the sequence panel to see them.

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Fibronectin	A, B, D, F, I, K	protein	89	Homo sapiens	P02751 (AlphaFold model)
Fibronectin-binding protein	C, E, G, H, J, L	protein	18	synthetic construct	P14738 (AlphaFold model)

Sequence of entity 1 (A, B, D, F, I, K), FASTA

>2RL0_1 Fibronectin (chains A, B, D, F, I, K)
EKCFDHAAGTSYVVGETWEKPYQGWMMVDCTCLGEGSGRITCTSRNRCNDQDTRTSYRIG
DTWSKKDNRGNLLQCICTGNGRGEWKCER

Sequence of entity 2 (C, E, G, H, J, L), FASTA

>2RL0_2 Fibronectin-binding protein (chains C, E, G, H, J, L)
GQVTTESNLVEFDEESTK

Primary citation

Crystal structures of fibronectin-binding sites from Staphylococcus aureus FnBPA in complex with fibronectin domains. Bingham, R.J., Meenan, N.A., Schwarz-Linek, U. et al. Proc Natl Acad Sci U S A (2008) 105:12254-12258. DOI 10.1073/pnas.0803556105 · PubMed

Other PDB entries of the same protein (UniProt P02751 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2CG7 1.2 Å, Second and third fibronectin type I module pair (crystal form II).
4LXO 1.42 Å, Crystal structure of 9,10Fn3-elegantin chimera
5DC4 1.48 Å, Crystal structure of monobody AS25/ABL1 SH2 domain complex, crystal a
2CG6 1.55 Å, Second and third fibronectin type I module pair (crystal form I).
5DC9 1.56 Å, Crystal structure of monobody AS25/ABL1 SH2 domain complex, crystal B
5N48 1.6 Å, Structure of Anticalin N9B in complex with extra-domain B of human oncofetal fibronectin
3CAL 1.7 Å, Crystal structure of the second and third fibronectin F1 modules in complex with a…
3ZRZ 1.7 Å, Crystal structure of the second and third fibronectin F1 modules in complex with a…
6MFA 1.75 Å, Fragment of human fibronectin containing the 4th-7th type III domains
1FNA 1.8 Å, Crystal structure of the tenth type III cell adhesion module of human fibronectin
2RKY 1.8 Å, Crystal structure of the fourth and fifth fibronectin F1 modules in complex with a…
4PZ5 1.96 Å, Crystal structure of the second and third fibronectin F1 modules in complex with a…

Browse structure collections

About this viewer

MolViewer shows 2RL0 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.