2STT: Human ETS1/DNA complex, 25 structures

Solution NMR structure of the human ETS1/DNA complex, 25 structures. Determined by solution NMR. Released 12 Mar 1997.

Method: Solution NMR
Organism: Homo sapiens
Chains: 3
Atoms: 1,488
Mol. weight: 21.67 kDa
Released: 12 Mar 1997

Explore 2STT in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2STT contains 7 α-helices and 4 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 7 helices, 4 β-strands

Element	Residues	Length	Sheet
α-helix	12-16	5
α-helix	27-35	9
α-helix	40-43	4
β-strand	45-46	2	1
β-strand	53-54	2	1
α-helix	59-67	9
α-helix	77-78	2
α-helix	79-83	5
α-helix	84	1
β-strand	92-94	3	1
β-strand	101-104	4	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
DNA (5'-d(tpcpgpapgpcpcpgpgpapapgptptpcpgp*a)-3')	B	DNA	17
DNA (5'-d(tpcpgpapapcptptpcpcpgpgpcptpcpgp*a)-3')	C	DNA	17
ETS1	A	protein	96	Homo sapiens	P14921 (AlphaFold model)

Sequence of entity 1 (B), FASTA

>2STT_1 DNA (5'-D(*TP*CP*GP*AP*GP*CP*CP*GP*GP*AP*AP*GP*TP*TP*CP*GP*A)-3') (chains B)
TCGAGCCGGAAGTTCGA

Sequence of entity 2 (C), FASTA

>2STT_2 DNA (5'-D(*TP*CP*GP*AP*AP*CP*TP*TP*CP*CP*GP*GP*CP*TP*CP*GP*A)-3') (chains C)
TCGAACTTCCGGCTCGA

Sequence of entity 3 (A), FASTA

>2STT_3 ETS1 (chains A)
VIPAAALAGYTGSGPIQLWQFLLELLTDKSCQSFISWTGDGWEFKLSDPDEVARRWGKRK
NKPKMNYEKLSRGLRYYYDKNIIHKTAGKRYVYRFV

Primary citation

Correction of the NMR structure of the ETS1/DNA complex. Werner, M.H., Clore, G.M., Fisher, C.L. et al. J Biomol NMR (1997) 10:317-328. DOI 10.1023/A:1018399711996 · PubMed

Other PDB entries of the same protein (UniProt P14921 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1GVJ 1.53 Å, Ets-1 DNA binding and autoinhibitory domains
4LG0 2.19 Å, Structure of a ternary FOXO1-ETS1 DNA complex
4L18 2.3 Å, Crystal structure of Runx1 and Ets1 bound to TCR alpha promoter (crystal form 3)
3WTS 2.35 Å, Crystal structure of the complex comprised of ETS1, RUNX1, CBFBETA, and the tcralpha…
3WTT 2.35 Å, Crystal structure of the complex comprised of phosphorylated ETS1, RUNX1, CBFBETA, and…
3WU1 2.4 Å, Crystal structure of the ETS1-RUNX1-DNA ternary complex
4L0Y 2.5 Å, Crystal structure of Runx1 and Ets1 bound to TCR alpha promoter (crystal form 1)
2NNY 2.58 Å, Crystal structure of the Ets1 dimer DNA complex.
3WU0 2.6 Å, Crystal structure of phosphorylated ETS-1 DNA binding and autoinhibitory domains (276-441)
3WTZ 2.61 Å, Crystal structure of ETS-1 DNA binding and autoinhibitory domains (276-441)
3WTU 2.7 Å, Crystal structure of the complex comprised of ETS1 (V170A), RUNX1, CBFBETA, and the…
3WTV 2.7 Å, Crystal structure of the complex comprised of ETS1(V170G), RUNX1, CBFBETA, and the…

Browse structure collections

About this viewer

MolViewer shows 2STT directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.