Crystal Structure of Human Calcium Calmodulin dependent Protein Kinase II delta isoform 1, CAMKD. Determined by X-ray diffraction at 2.3 Å resolution. Released 26 Feb 2008.
Explore 2VN9 in 3D Show helices and sheets RCSB PDB PDBe
2VN9 contains 34 α-helices and 26 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 0-13 | 4 | |
| β-strand | 14-22 | 9 | 1 |
| β-strand | 26-33 | 8 | 1 |
| β-strand | 39-46 | 8 | 1 |
| α-helix | 52-67 | 16 | |
| β-strand | 73 | 1 | 2 |
| β-strand | 76-82 | 7 | 1 |
| β-strand | 85-91 | 7 | 1 |
| β-strand | 97 | 1 | 2 |
| α-helix | 98-104 | 7 | |
| α-helix | 110-129 | 20 | |
| β-strand | 132-133 | 2 | 3 |
| α-helix | 139-141 | 3 | |
| β-strand | 142-144 | 3 | 2 |
| α-helix | 151-152 | 2 | |
| β-strand | 153-155 | 3 | 2 |
| β-strand | 162-163 | 2 | 3 |
| β-strand | 170 | 1 | 4 |
| α-helix | 178-180 | 3 | |
| α-helix | 183-186 | 4 | |
| β-strand | 191 | 1 | 4 |
| α-helix | 194-209 | 16 | |
| α-helix | 219-228 | 10 | |
| α-helix | 237-240 | 4 | |
| α-helix | 243-252 | 10 | |
| α-helix | 261-262 | 2 | |
| α-helix | 263-266 | 4 | |
| α-helix | 270-273 | 4 | |
| α-helix | 275-278 | 4 | |
| α-helix | 285-299 | 15 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 0-13 | 4 | |
| β-strand | 14-22 | 9 | 5 |
| β-strand | 26-33 | 8 | 5 |
| β-strand | 39-46 | 8 | 5 |
| α-helix | 52-67 | 16 | |
| β-strand | 73 | 1 | 6 |
| β-strand | 76-82 | 7 | 5 |
| β-strand | 85-91 | 7 | 5 |
| β-strand | 97 | 1 | 6 |
| α-helix | 98-103 | 6 | |
| α-helix | 110-129 | 20 | |
| β-strand | 132-133 | 2 | 7 |
| α-helix | 139-141 | 3 | |
| β-strand | 142-144 | 3 | 6 |
| α-helix | 151-152 | 2 | |
| β-strand | 153-155 | 3 | 6 |
| β-strand | 162-163 | 2 | 7 |
| β-strand | 170 | 1 | 8 |
| α-helix | 178-180 | 3 | |
| α-helix | 183-186 | 4 | |
| β-strand | 191 | 1 | 8 |
| α-helix | 194-209 | 16 | |
| α-helix | 219-227 | 9 | |
| α-helix | 243-252 | 10 | |
| α-helix | 261-262 | 2 | |
| α-helix | 263-266 | 4 | |
| α-helix | 270-273 | 4 | |
| α-helix | 275-278 | 4 | |
| α-helix | 285-299 | 15 | |
| α-helix | 307-308 | 2 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Calcium/calmodulin-dependent protein kinase type II delta chain | A, B | protein | 301 | Homo sapiens | Q13557 (AlphaFold model) |
>2VN9_1 CALCIUM/CALMODULIN-DEPENDENT PROTEIN KINASE TYPE II DELTA CHAIN (chains A, B) SMTDEYQLFEELGKGAFSVVRRCMKIPTGQEYAAKIINTKKLSARDHQKLEREARICRLL KHPNIVRLHDSISEEGFHYLVFDLVTGGELFEDIVAREYYSEADASHCIQQILESVNHCH LNGIVHRDLKPENLLLASKSKGAAVKLADFGLAIEVQGDQQAWFGFAGTPGYLSPEVLRK DPYGKPVDMWACGVILYILLVGYPPFWDEDQHRLYQQIKAGAYDFPSPEWDTVTPEAKDL INKMLTINPAKRITASEALKHPWICQRSTVASMMHRQETVDCLKKFNARRKLKGAILTTM L
| ID | Name | Formula | Copies |
|---|---|---|---|
| PO4 | Phosphate ion | O4 P | 4 |
| GVD | [4-({4-[(5-cyclopropyl-1H-pyrazol-3-yl)amino]quinazolin-2-yl}imino)cyclohexa-2,… | C22 H19 N7 | 2 |
Water and common crystallization additives (CL, EPE) are not listed.
Structure of the Camkiidelta/Calmodulin Complex Reveals the Molecular Mechanism of Camkii Kinase Activation. Rellos, P., Pike, A.C.W., Niesen, F.H. et al. PLoS Biol (2010) 8:426. DOI 10.1371/JOURNAL.PBIO.1000426 · PubMed
Other PDB entries of the same protein (UniProt Q13557 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 2VN9 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.