Crystal structure of CC chemokine 5 (CCL5) oligomer in complex with heparin. Determined by X-ray diffraction at 2.55 Å resolution. Released 13 Apr 2016.
Explore 5DNF in 3D Show helices and sheets RCSB PDB PDBe
5DNF contains 36 α-helices and 43 β-strands across 9 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 5 | 1 | 1 |
| β-strand | 8-10 | 3 | 2 |
| α-helix | 18-20 | 3 | |
| α-helix | 21-23 | 3 | |
| β-strand | 24-29 | 6 | 3 |
| α-helix | 30-31 | 2 | |
| β-strand | 39-43 | 5 | 3 |
| β-strand | 48-51 | 4 | 3 |
| α-helix | 56-66 | 11 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 6 | 1 | 3 |
| β-strand | 8-10 | 3 | 2 |
| α-helix | 18-20 | 3 | |
| α-helix | 21-23 | 3 | |
| β-strand | 24-29 | 6 | 1 |
| α-helix | 30-31 | 2 | |
| β-strand | 39-43 | 5 | 1 |
| β-strand | 48-51 | 4 | 1 |
| α-helix | 56-66 | 11 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 5 | 1 | 4 |
| β-strand | 8-10 | 3 | 5 |
| α-helix | 18-19 | 2 | |
| α-helix | 21-23 | 3 | |
| β-strand | 24-29 | 6 | 6 |
| α-helix | 30-31 | 2 | |
| β-strand | 39-43 | 5 | 6 |
| β-strand | 48-51 | 4 | 6 |
| α-helix | 56-66 | 11 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 18-20 | 3 | |
| α-helix | 21-23 | 3 | |
| β-strand | 24-29 | 6 | 13 |
| α-helix | 30-31 | 2 | |
| β-strand | 39-43 | 5 | 13 |
| β-strand | 48-51 | 4 | 13 |
| α-helix | 56-66 | 11 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| C-C motif chemokine 5 | A, B, C, D, E, F, G, H, I | protein | 65 | Homo sapiens | P13501 (AlphaFold model) |
>5DNF_1 C-C motif chemokine 5 (chains A, B, C, D, E, F, G, H, I) SSDTTPCCFAYIARPLPRAHIKEYFYTSGKCSNPAVVFVTRKNRQVCANPEKKWVREYIN SLEMS
Water and common crystallization additives (TRS, CL, SO4) are not listed.
Structural basis for oligomerization and glycosaminoglycan binding of CCL5 and CCL3. Liang, W.G., Triandafillou, C.G., Huang, T.Y. et al. Proc Natl Acad Sci U S A (2016) 113:5000-5005. DOI 10.1073/pnas.1523981113 · PubMed
Other PDB entries of the same protein (UniProt P13501 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 5DNF directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.