2YU7: SHP-1 C-terminal SH2 domain

Solution structure of the SHP-1 C-terminal SH2 domain complexed with a tyrosine-phosphorylated peptide from NKG2A. Determined by solution NMR. Released 15 Apr 2008.

Method: Solution NMR
Organism: Homo sapiens
Chains: 2
Atoms: 1,014
Mol. weight: 14.44 kDa
Released: 15 Apr 2008

Explore 2YU7 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2YU7 contains 5 α-helices and 12 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 11 β-strands

Element	Residues	Length	Sheet
β-strand	11	1	1
α-helix	15-25	11
β-strand	30-35	6	1
β-strand	43-52	10	1
α-helix	59	1
β-strand	60-67	8	1
β-strand	68	1	2
β-strand	74	1	3
β-strand	75	1	2
β-strand	82	1	3
α-helix	85-94	10
β-strand	97-98	2	4
β-strand	104-105	2	4
β-strand	109-110	2	1

Chain B: 2 helices, 1 β-strand

Element	Residues	Length	Sheet
α-helix	7	1
β-strand	8	1	1
α-helix	9	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Tyrosine-protein phosphatase non-receptor type 6	A	protein	118	Homo sapiens	P29350 (AlphaFold model)
natural killer group 2A	B	protein	15		P26715 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2YU7_1 Tyrosine-protein phosphatase non-receptor type 6 (chains A)
GSSGSSGWYHGHMSGGQAETLLQAKGEPWTFLVRESLSQPGDFVLSVLSDQPKAGPGSPL
RVTHIKVMCEGGRYTVGGLETFDSLTDLVEHFKKTGIEEASGAFVYLRQPYYSGPSSG

Sequence of entity 2 (B), FASTA

>2YU7_2 natural killer group 2A (chains B)
ATEQEITYAELNLQK

Primary citation

Solution structure of the SHP-1 C-terminal SH2 domain complexed with a tyrosine-phosphorylated peptide from NKG2A. Kasai, T., Koshiba, S., Inoue, M. et al. To be published.

Other PDB entries of the same protein (UniProt P29350 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4GRZ 1.37 Å, Crystal structure of SHP1 catalytic domain with PO4
4HJP 1.4 Å, SHP-1 catalytic domain WPD loop open
4GRY 1.7 Å, Crystal structure of SHP1 catalytic domain with SO4
8YHI 1.75 Å, The Crystal Structure of SHP1 from Biortus.
4GS0 1.8 Å, Crystal structure of SHP1 catalytic domain with JAK1 activation loop peptide
4HJQ 1.8 Å, SHP-1 catalytic domain WPD loop closed
1FPR 2.5 Å, Crystal structure of the complex formed between the catalytic domain of shp-1 and an in…
1GWZ 2.5 Å, Crystal structure of the catalytic domain of the protein tyrosine phosphatase shp-1
6SM5 2.75 Å, MbC/SHP1-C-SH2 complex
2B3O 2.8 Å, Crystal structure of human tyrosine phosphatase SHP-1
3PS5 3.1 Å, Crystal structure of the full-length Human Protein Tyrosine Phosphatase SHP-1
1X6C Solution structures of the SH2 domain of human protein-tyrosine phosphatase SHP-1

Browse structure collections

About this viewer

MolViewer shows 2YU7 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.