3BPO: IL13-IL4R-IL13Ra ternary complex

Crystal structure of the IL13-IL4R-IL13Ra ternary complex. Determined by X-ray diffraction at 3.0 Å resolution. Released 5 Feb 2008.

Method: X-ray diffraction
Resolution: 3.0 Å
Organism: Homo sapiens
Chains: 3
Atoms: 4,574
Mol. weight: 74.61 kDa
Ligands: NAG
Released: 5 Feb 2008

Explore 3BPO in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3BPO contains 18 α-helices and 41 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 6 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	7-20	14
α-helix	29-31	3
β-strand	34-35	2	1
α-helix	45-49	5
α-helix	58-60	3
α-helix	61-67	7
β-strand	89-90	2	1
α-helix	92-109	18

Chain B: 6 helices, 16 β-strands

Element	Residues	Length	Sheet
β-strand	3-11	9	2
β-strand	16-23	8	2
α-helix	29-32	4
β-strand	33-39	7	3
β-strand	46-49	4	3
β-strand	52-53	2	2
β-strand	58-64	7	2
β-strand	74-80	7	3
β-strand	87-90	4	3
β-strand	96	1	2
α-helix	98-101	4
β-strand	102-109	8	4
β-strand	113-119	7	4
α-helix	128-130	3
β-strand	132-140	9	5
β-strand	147-152	6	5
β-strand	158-162	5	4
α-helix	163-165	3
β-strand	172-180	9	5
α-helix	185-187	3
α-helix	189-191	3
β-strand	194-195	2	5

Chain C: 6 helices, 23 β-strands

Element	Residues	Length	Sheet
α-helix	33-35	3
β-strand	36-43	8	6
β-strand	47-53	7	6
β-strand	66-68	3	1
β-strand	77-79	3	1
β-strand	83-87	5	6
β-strand	94-100	7	1
β-strand	114-118	5	1
β-strand	130-137	8	7
β-strand	141-147	7	7
β-strand	158-164	7	8
α-helix	170	1
β-strand	171-172	2	8
α-helix	173	1
β-strand	176-179	4	7
β-strand	182-188	7	7
β-strand	202-208	7	8
β-strand	216-220	5	8
β-strand	226-227	2	7
α-helix	228-230	3
β-strand	232-239	8	9
β-strand	242-248	7	9
α-helix	255-257	3
β-strand	258-265	8	10
β-strand	272-277	6	10
β-strand	294-300	7	9
β-strand	308-316	9	10
α-helix	329-333	5
β-strand	334-336	3	10

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Interleukin 13	A	protein	127	Homo sapiens	P35225 (AlphaFold model)
Interleukin-4 receptor alpha chain	B	protein	205	Homo sapiens	P24394 (AlphaFold model)
Interleukin-13 receptor alpha-1 chain	C	protein	314	Homo sapiens	P78552 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>3BPO_1 Interleukin 13 (chains A)
PGPVPPSTALRELIEELVNITQNQKAPLCNGSMVWSINLTTAGMYCAALESLINVSGCSA
IEKTQRMLSGFCPHKVSAGQFSSLHVRDTKIEVAQFVKDLLLHLKKLFREGQFNRNFESI
IICRDRT

Sequence of entity 2 (B), FASTA

>3BPO_2 Interleukin-4 receptor alpha chain (chains B)
ADPFKVLQEPTCVSDYMSISTCEWKMNGPTQCSTELRLLYQLVFLLSEAHTCIPENNGGA
GCVCHLLMDDVVSADQYTLDLWAGQQLLWKGSFKPSEHVKPRAPGNLTVHTQVSDTLLLT
WSNPYPPDNYLYNHLTYAVNIWSENDPADFRIYQVTYLEPSLRIAASTLKSGISYRARVR
AWAQCYNTTWSEWSPSTKWHNSYRE

Sequence of entity 3 (C), FASTA

>3BPO_3 Interleukin-13 receptor alpha-1 chain (chains C)
TETQPPVTNLSVSVENLCTVIWTWNPPEGASSNCSLWYFSHFGDKQDKKIAPETRRSIEV
PLNERICLQVGSQCSTNESEKPSILVEKCISPPEGDPESAVTELQCIWHNLSYMKCSWLP
GRNTSPDTNYTLYYWHRSLEKIHQCENIFREGQYFGCSFDLTKVKDSSFEQHSVQIMVKD
NAGKIKPSFNIVPLTSRVKPDPPHIKNLSFHNDDLYVQWENPQNFISRCLFYEVEVNNSQ
TETHNVFYVQEAKCENPEFERNVENTSCFMVPGVLPDTLNTVRIRVKTNKLCYEDDKLWS
NWSQEMSIGKKRNS

Ligands and cofactors

ID	Name	Formula	Copies
NAG	2-acetamido-2-deoxy-beta-D-glucopyranose	C8 H15 N O6	1

Primary citation

Molecular and Structural Basis of Cytokine Receptor Pleiotropy in the Interleukin-4/13 System. Laporte, S.L., Juo, Z.S., Vaclavikova, J. et al. Cell (2008) 132:259-272. DOI 10.1016/j.cell.2007.12.030 · PubMed

Other PDB entries of the same protein (UniProt P35225 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3L5X 1.9 Å, Crystal structure of the complex between IL-13 and H2L6 FAB
4I77 1.9 Å, Lebrikizumab Fab bound to IL-13
5L6Y 1.99 Å, il13 in complex with tralokinumab
3L5W 2.0 Å, Crystal structure of the complex between IL-13 and C836 FAB
4PS4 2.8 Å, Crystal structure of the complex between IL-13 and M1295 FAB
5E4E 3.0 Å, Engineered Interleukin-13 bound to receptor
3LB6 3.05 Å, The structure of IL-13 in complex with IL-13Ralpha2
3G6D 3.2 Å, Crystal structure of the complex between CNTO607 Fab and IL-13
8BLQ 3.97 Å, Cryo-EM structure of the CODV-IL13-RefAb triple complex
1GA3 NMR structure of interleukin-13
1IJZ Solution Structure of Human IL-13
1IK0 Solution Structure of Human IL-13

Browse structure collections

About this viewer

MolViewer shows 3BPO directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.