3COQ: Dimerization in DNA Recognition by Gal4

Structural Basis for Dimerization in DNA Recognition by Gal4. Determined by X-ray diffraction at 2.4 Å resolution. Released 1 Jul 2008.

Method: X-ray diffraction
Resolution: 2.4 Å
Organisms: synthetic construct, Saccharomyces cerevisiae
Chains: 4
Atoms: 2,313
Mol. weight: 33.62 kDa
Ligands: ZN
Released: 1 Jul 2008

Explore 3COQ in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3COQ contains 14 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 7 helices, 0 β-strands

Element	Residues	Length
α-helix	9-11	3
α-helix	12-13	2
α-helix	14-18	5
α-helix	29-33	5
α-helix	51-71	21
α-helix	77-82	6
α-helix	86-93	8

Chain B: 7 helices, 0 β-strands

Element	Residues	Length
α-helix	9-11	3
α-helix	12-17	6
α-helix	29-34	6
α-helix	41-45	5
α-helix	51-71	21
α-helix	74-81	8
α-helix	86-94	9

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
DNA (5'-d(dapdcpdcpdgpdgpdapdgpdgpdapdcpdapdgpdtpdcpdcpdtpdcpdcpdgpdg)-3')	D	DNA	20	synthetic construct
DNA (5'-d(dtpdcpdcpdgpdgpdapdgpdgpdapdcpdtpdgpdtpdcpdcpdtpdcpdcpdgpdg)-3')	E	DNA	20	synthetic construct
Regulatory protein GAL4	A, B	protein	89	Saccharomyces cerevisiae	P04386 (AlphaFold model)

Sequence of entity 1 (D), FASTA

>3COQ_1 DNA (5'-D(*DAP*DCP*DCP*DGP*DGP*DAP*DGP*DGP*DAP*DCP*DAP*DGP*DTP*DCP*DCP*DTP*DCP*DCP*DGP*DG)-3') (chains D)
ACCGGAGGACAGTCCTCCGG

Sequence of entity 2 (E), FASTA

>3COQ_2 DNA (5'-D(*DTP*DCP*DCP*DGP*DGP*DAP*DGP*DGP*DAP*DCP*DTP*DGP*DTP*DCP*DCP*DTP*DCP*DCP*DGP*DG)-3') (chains E)
TCCGGAGGACTGTCCTCCGG

Sequence of entity 3 (A, B), FASTA

>3COQ_3 Regulatory protein GAL4 (chains A, B)
EQACDICRLKKLKCSKEKPKCAKCLKNNWECRYSPKTKRSPLTRAHLTEVESRLERLEQL
FLLIFPREDLDMILKMDSLQDIKALLTGL

Ligands and cofactors

ID	Name	Formula	Copies
ZN	Zinc ion	Zn	4

Water and common crystallization additives (MPD) are not listed.

Primary citation

Structural basis for dimerization in DNA recognition by gal4. Hong, M., Fitzgerald, M.X., Harper, S. et al. Structure (2008) 16:1019-1026. DOI 10.1016/j.str.2008.03.015 · PubMed

Other PDB entries of the same protein (UniProt P04386 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1D66 2.7 Å, DNA recognition by GAL4: structure of a protein/dna complex
3BTS 2.7 Å, Crystal structure of a ternary complex of the transcriptional repressor Gal80p (Gal80S0…
7UIO 3.3 Å, Mediator-PIC Early (Composite Model)
7UIK 7.7 Å, Mediator-PIC Early (Tail A + Upstream DNA & Activator)
1AW6 GAL4 (CD), NMR, 24 structures
1HBW Solution nmr structure of the dimerization domain of the yeast transcriptional activator…

Browse structure collections

About this viewer

MolViewer shows 3COQ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.