3CWZ: RAB6(GTP)-R6IP1 complex

Structure of RAB6(GTP)-R6IP1 complex. Determined by X-ray diffraction at 3.2 Å resolution. Released 18 Nov 2008.

Method: X-ray diffraction
Resolution: 3.2 Å
Organisms: Homo sapiens, Mus musculus
Chains: 2
Atoms: 3,872
Mol. weight: 66.16 kDa
Ligands: MG, GTP
Released: 18 Nov 2008

Explore 3CWZ in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3CWZ contains 19 α-helices and 18 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 7 helices, 6 β-strands

Element	Residues	Length	Sheet
β-strand	13-19	7	1
α-helix	26-35	10
β-strand	48-54	7	1
β-strand	63-69	7	1
α-helix	73-78	6
α-helix	79-83	5
β-strand	88-94	7	1
α-helix	98-102	5
α-helix	104-114	11
β-strand	120-126	7	1
α-helix	138-147	10
β-strand	151-154	4	1
α-helix	163-172	10

Chain B: 12 helices, 12 β-strands

Element	Residues	Length	Sheet
α-helix	718-748	31
α-helix	760-781	22
β-strand	784	1	2
α-helix	792-806	15
α-helix	833-837	5
α-helix	840-848	9
α-helix	856-870	15
α-helix	873-880	8
α-helix	884-890	7
β-strand	891	1	2
α-helix	900-910	11
α-helix	911-914	4
β-strand	929-938	10	3
β-strand	951-957	7	4
β-strand	961	1	4
β-strand	965-966	2	4
α-helix	967-968	2
β-strand	973-979	7	3
β-strand	984-991	8	4
β-strand	1000-1009	10	3
β-strand	1015-1024	10	3
β-strand	1034-1038	5	4
β-strand	1040-1041	2	3
α-helix	1042-1044	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Ras-related protein Rab-6A	A	protein	188	Homo sapiens	P20340 (AlphaFold model)
Rab6-interacting protein 1	B	protein	384	Mus musculus	Q6PAL8 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>3CWZ_1 Ras-related protein Rab-6A (chains A)
GNPLRKFKLVFLGEQSVGKTSLITRFMYDSFDNTYQATIGIDFLSKTMYLEDRTVRLQLW
DTAGLERFRSLIPSYIRDSTVAVVVYDITNVNSFQQTTKWIDDVRTERGSDVIIMLVGNK
TDLADKRQVSIEEGERKAKELNVMFIETSAKAGYNVKQLFRRVAAALPGMESTQDRSRED
MIDIKLEK

Sequence of entity 2 (B), FASTA

>3CWZ_2 Rab6-interacting protein 1 (chains B)
EHLRLDNDQREKYIQEARNMGSTIRQPKLSNLSPSVIAQTNWKFVEGLLKECRNKTKRML
VEKMGREAVELGHGEVNITGVEENTLIASLCDLLERIWSHGLQVKQGKSALWSHLLHYQE
NRQRKLTSGSLSTSGILLDSERRKSDASAVMSPLRISLIQDMRHIQNIGEIKTDVGKARA
WVRLSMEKKLLSRHLKQLLSDHELTKKLYKRYAFLRCDDEKEQFLYHLLSFNAVDYFCFT
NVFTTILIPYHILIVPSKKLGGSMFTANPWICISGELGETQILQIPRNVLEMTFECQNLG
KLTTVQIGHDNSGLYAKWLVECVMVRNEVTGHTYKFPCGRWLGKGMDDGSLERVLVGELL
TSLPEVDERPCRTPPLQQSPSVIR

Ligands and cofactors

ID	Name	Formula	Copies
MG	Magnesium ion	Mg	1
GTP	Guanosine-5'-triphosphate	C10 H16 N5 O14 P3	1

Primary citation

Structural basis for recruitment of Rab6-interacting protein 1 to Golgi via a RUN domain. Recacha, R., Boulet, A., Jollivet, F. et al. Structure (2009) 17:21-30. DOI 10.1016/j.str.2008.10.014 · PubMed

Other PDB entries of the same protein (UniProt P20340 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1YZQ 1.78 Å, GppNHp-Bound Rab6 GTPase
2GIL 1.82 Å, Structure of the extremely slow GTPase Rab6A in the GTP bound form at 1.8 resolution
4DKX 1.9 Å, Crystal Structure of the Rab 6A'(Q72L)
5LEF 2.09 Å, Rab6A:Kif20A complex
3BBP 3.0 Å, Rab6-GTP:GCC185 Rab binding domain complex

Browse structure collections

About this viewer

MolViewer shows 3CWZ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.