3E21: FAF-1 UBA Domain
Crystal structure of FAF-1 UBA Domain. Determined by X-ray diffraction at 1.73 Å resolution. Released 11 Aug 2009.
- Method
- X-ray diffraction
- Resolution
- 1.73 Å
- Organism
- Homo sapiens
- Chains
- 1
- Atoms
- 341
- Mol. weight
- 4.93 kDa
- Released
- 11 Aug 2009
Explore 3E21 in 3D
Show helices and sheets
RCSB PDB
PDBe
Secondary structure: helices and β-sheets
3E21 contains 3 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
Chain A: 3 helices, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 7-18 | 12 | |
| α-helix | 23-32 | 10 | |
| α-helix | 37-41 | 5 | |
Molecules and chains
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|
| FAS-associated factor 1 | A | protein | 45 | Homo sapiens | Q9UNN5 (AlphaFold model) |
Sequence of entity 1 (A), FASTA
>3E21_1 FAS-associated factor 1 (chains A)
GSMDREMILADFQACTGIENIDEAITLLEQNNWDLVAAINGVIPQ
Primary citation
Crystal structure of FAF-1 UBA Domain. Park, J.K., Kim, E.E. To be published.
Other PDB entries of the same protein (UniProt Q9UNN5 (AlphaFold model), which also has an AlphaFold model), best resolution first:
- 7FGN 1.2 Å, The crystal structure of the FAF1 UBL1
- 3QX1 1.6 Å, Crystal structure of FAF1 UBX domain
- 3QQ8 2.0 Å, Crystal structure of p97-N in complex with FAF1-UBX
- 3QWZ 2.0 Å, Crystal structure of FAF1 UBX-p97N-domain complex
- 3QC8 2.2 Å, Crystal Structure of FAF1 UBX Domain In Complex with p97/VCP N Domain Reveals The…
- 7FGM 2.2 Å, The complex crystals structure of the FAF1 UBL1_L-Hsp70 NBD with ADP and phosphate
- 3QCA 2.9 Å, Crystal Structure of FAF1 UBX Domain In Complex with p97/VCP N Domain Reveals The…
- 3R3M 3.0 Å, Crystal structure of the FAF1 UBX domain
- 8KG2 3.1 Å, Crystal structure of p97-N/D1 hexamer in complex with FAF1-UBX domain
- 9YW2 3.27 Å, Complex structure of human p97 bound to Faf1 and Ufd1 (NTD focused)
- 11TA 3.58 Å, Cryo-EM structure of substrate engaged p97-Ufd1-NPL4-Faf1 complex (motor focused)
- 11VE 3.85 Å, Cryo-EM structure of substrate engaged p97-Ufd1-NPL4-Faf1 complex (State1)
Browse structure collections
About this viewer
MolViewer shows 3E21 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.