3EML: Human Adenosine A2A receptor/T4 lysozyme chimera

The 2.6 A Crystal Structure of a Human A2A Adenosine Receptor bound to ZM241385. Determined by X-ray diffraction at 2.6 Å resolution. Released 14 Oct 2008.

Method: X-ray diffraction
Resolution: 2.6 Å
Organisms: Homo sapiens, Enterobacteria phage T4
Chains: 1
Atoms: 3,757
Mol. weight: 57.17 kDa
Ligands: ZMA, STE
Released: 14 Oct 2008

Explore 3EML in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3EML contains 29 α-helices and 8 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 29 helices, 8 β-strands

Element	Residues	Length	Sheet
α-helix	7-33	27
α-helix	35-37	3
α-helix	41-54	14
α-helix	55-59	5
α-helix	60-66	7
β-strand	71-72	2	1
α-helix	74-106	33
α-helix	109-111	3
α-helix	118-136	19
α-helix	139-141	3
β-strand	164-165	2	1
α-helix	168-171	4
α-helix	174-175	2
α-helix	176-187	12
α-helix	188-204	17
α-helix	206-208	3
α-helix	1003-1010	8
β-strand	1014-1015	2	2
β-strand	1016	1	3
β-strand	1017-1019	3	2
β-strand	1025-1028	4	2
β-strand	1031-1034	4	2
α-helix	1039-1050	12
β-strand	1057	1	3
α-helix	1060-1080	21
α-helix	1084-1090	7
α-helix	1093-1106	14
α-helix	1108-1111	4
α-helix	1115-1122	8
α-helix	1126-1133	8
α-helix	1137-1141	5
α-helix	1143-1155	13
α-helix	1159-258	40
α-helix	263-266	4
α-helix	267-291	25
α-helix	293-302	10
α-helix	303-307	5

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Human Adenosine A2A receptor/T4 lysozyme chimera	A	protein	488	Homo sapiens, Enterobacteria phage T4	P00720, P29274 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>3EML_1 Human Adenosine A2A receptor/T4 lysozyme chimera (chains A)
DYKDDDDAMGQPVGAPPIMGSSVYITVELAIAVLAILGNVLVCWAVWLNSNLQNVTNYFV
VSLAAADIAVGVLAIPFAITISTGFCAACHGCLFIACFVLVLTQSSIFSLLAIAIDRYIA
IRIPLRYNGLVTGTRAKGIIAICWVLSFAIGLTPMLGWNNCGQPKEGKNHSQGCGEGQVA
CLFEDVVPMNYMVYFNFFACVLVPLLLMLGVYLRIFLAARRQLNIFEMLRIDEGLRLKIY
KDTEGYYTIGIGHLLTKSPSLNAAKSELDKAIGRNTNGVITKDEAEKLFNQDVDAAVRGI
LRNAKLKPVYDSLDAVRRAALINMVFQMGETGVAGFTNSLRMLQQKRWDEAAVNLAKSRW
YNQTPNRAKRVITTFRTGTWDAYRSTLQKEVHAAKSLAIIVGLFALCWLPLHIINCFTFF
CPDCSHAPLWLMYLAIVLSHTNSVVNPFIYAYRIREFRQTFRKIIRSHVLRQQEPFKAHH
HHHHHHHH

Ligands and cofactors

ID	Name	Formula	Copies
ZMA	4-{2-[(7-amino-2-furan-2-yl[1,2,4]triazolo[1,5-a][1,3,5]triazin-5-yl)amino]ethy…	C16 H15 N7 O2	1
STE	Stearic acid	C18 H36 O2	5

Water and common crystallization additives (SO4) are not listed.

Primary citation

The 2.6 Angstrom Crystal Structure of a Human A2A Adenosine Receptor Bound to an Antagonist. Jaakola, V.P., Griffith, M.T., Hanson, M.A. et al. Science (2008) 322:1211-1217. DOI 10.1126/science.1164772 · PubMed

Other PDB entries of the same protein (UniProt P00720), best resolution first:

2O7A 0.84 Å, T4 lysozyme C-terminal fragment
5JDT 1.0 Å, Structure of Spin-labelled T4 lysozyme mutant L118C-R1 at 100K
7LOE 1.01 Å, T4 lysozyme mutant L99A in complex with 1-fluoranylnaphthalene
7LOD 1.02 Å, T4 lysozyme mutant L99A in complex with 1-fluoranyl-4-iodanyl-benzene
7LX8 1.03 Å, T4 lysozyme mutant L99A
5XPF 1.04 Å, High-resolution X-ray structure of the T26H mutant of T4 lysozyme
6BG3 1.05 Å, Structure of (3S,4S)-1-benzyl-4-(3-(3-(trifluoromethyl)phenyl)ureido)piperidin-3-yl…
7LOF 1.05 Å, T4 lysozyme mutant L99A in complex with 2-butylthiophene
7LX6 1.05 Å, T4 lysozyme mutant L99A
7LX7 1.05 Å, T4 lysozyme mutant L99A
1SWY 1.06 Å, Use of a Halide Binding Site to Bypass the 1000-atom Limit to Ab initio Structure…
1SWZ 1.06 Å, Use of an ion-binding site to bypass the 1000-atom limit to ab initio structure…

Browse more

3EML is part of these collections:

GPCRs and cell signaling

About this viewer

MolViewer shows 3EML directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.