3ESK: HOP TPR2A domain

Structure of HOP TPR2A domain in complex with the non-cognate Hsc70 peptide ligand. Determined by X-ray diffraction at 2.05 Å resolution. Released 7 Jul 2009.

Method: X-ray diffraction
Resolution: 2.05 Å
Organism: Homo sapiens
Chains: 2
Atoms: 1,180
Mol. weight: 16.47 kDa
Ligands: NI
Released: 7 Jul 2009

Explore 3ESK in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3ESK contains 8 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 7 helices, 0 β-strands

Element	Residues	Length
α-helix	223-236	14
α-helix	241-254	14
α-helix	259-272	14
α-helix	275-292	18
α-helix	296-312	17
α-helix	316-329	14
α-helix	333-348	16

Chain B: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	5-9	5

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Stress-induced-phosphoprotein 1	A	protein	129	Homo sapiens	P31948 (AlphaFold model)
Heat shock cognate 71 kDa protein	B	protein	12	Homo sapiens	P11142 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>3ESK_1 Stress-induced-phosphoprotein 1 (chains A)
GKQALKEKELGNDAYKKKDFDTALKHYDKAKELDPTNMTYITNQAAVYFEKGDYNKCREL
CEKAIEVGRENREDYRQIAKAYARIGNSYFKEEKYKDAIHFYNKSLAEHRTPDVLKKCQQ
AEKILKEQE

Sequence of entity 2 (B), FASTA

>3ESK_2 Heat shock cognate 71 kDa protein (chains B)
GASSGPTIEEVD

Ligands and cofactors

ID	Name	Formula	Copies
NI	Nickel (II) ion	Ni	1

Primary citation

Electrostatic interactions of Hsp-organizing protein tetratricopeptide domains with Hsp70 and Hsp90: computational analysis and protein engineering. Kajander, T., Sachs, J.N., Goldman, A. et al. J Biol Chem (2009) 284:25364-25374. DOI 10.1074/jbc.M109.033894 · PubMed

Other PDB entries of the same protein (UniProt P31948 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1ELW 1.6 Å, Crystal structure of the TPR1 domain of HOP in complex with a HSC70 peptide
1ELR 1.9 Å, Crystal structure of the TPR2A domain of HOP in complex with the HSP90 peptide MEEVD
9QQU 2.13 Å, Crystal structure of an engineered TPR domain in complex with the HSP90 peptide MEEVD
3FWV 2.2 Å, Crystal Structure of a Redesigned TPR Protein, T-MOD(VMY), in Complex with MEEVF Peptide
7KW7 3.57 Å, Atomic cryoEM structure of Hsp90-Hsp70-Hop-GR
2LNI Solution NMR Structure of Stress-induced-phosphoprotein 1 STI1 from Homo sapiens,…
2NC9 Apo solution structure of Hop TPR2A

Browse structure collections

About this viewer

MolViewer shows 3ESK directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.