3EW3: Prolactin

the 1:2 complex between a Nterminal elongated prolactin and the extra cellular domain of the rat prolactin receptor. Determined by X-ray diffraction at 3.8 Å resolution. Released 3 Nov 2009.

Method: X-ray diffraction
Resolution: 3.8 Å
Organisms: Homo sapiens, Rattus norvegicus
Chains: 3
Atoms: 4,694
Mol. weight: 75.68 kDa
Released: 3 Nov 2009

Explore 3EW3 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3EW3 contains 10 α-helices and 39 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 0 β-strands

Element	Residues	Length
α-helix	15-44	30
α-helix	59-61	3
α-helix	77-103	27
α-helix	112-136	25
α-helix	161-190	30

Chain B: 3 helices, 20 β-strands

Element	Residues	Length	Sheet
β-strand	8-13	6	1
β-strand	14	1	2
β-strand	20-25	6	1
β-strand	34-41	8	3
β-strand	49-50	2	3
β-strand	53	1	1
β-strand	61-64	4	1
β-strand	74-83	10	3
β-strand	88	1	3
β-strand	93-96	4	3
α-helix	97-99	3
β-strand	101	1	2
α-helix	103-106	4
β-strand	107-115	9	4
β-strand	121-128	8	4
β-strand	142	1	5
β-strand	145-150	6	6
β-strand	157-160	4	6
β-strand	166-169	4	4
β-strand	178-183	6	6
β-strand	186	1	5
α-helix	190-197	8
β-strand	198-200	3	6

Chain C: 2 helices, 19 β-strands

Element	Residues	Length	Sheet
β-strand	8-13	6	7
β-strand	14	1	8
β-strand	20-25	6	7
β-strand	38-42	5	9
β-strand	49-50	2	9
β-strand	53	1	7
α-helix	55-57	3
β-strand	61-64	4	7
β-strand	75-79	5	9
β-strand	80-83	4	10
β-strand	86-89	4	10
α-helix	90-92	3
β-strand	93-95	3	9
β-strand	101	1	8
β-strand	109-111	3	11
β-strand	123-127	5	11
β-strand	142-149	8	12
β-strand	157-162	6	12
β-strand	166-169	4	11
β-strand	179-186	8	12
β-strand	198-199	2	12

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Prolactin	A	protein	203	Homo sapiens	P01236 (AlphaFold model)
Prolactin receptor	B, C	protein	221	Rattus norvegicus	P05710 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>3EW3_1 Prolactin (chains A)
MAQHPPYCRNQPGKCQIPLRDLFDRAVVLSHYIHNLSSEMFSEFDKRYTHGRGFITKAIN
SCHTSSLATPEDKEQAQQMNQKDFLSLIVSILRSWNEPLYHLVTEVRGMQEAPEAILSKA
VEIEEQTKRLLEGMELIVSQVHPETKENEIYPVWSGLPSLQMADEESRLSAYYNLLHCLR
RDSHKIDNYLKLLKCRIIHNNNC

Sequence of entity 2 (B, C), FASTA

>3EW3_2 Prolactin receptor (chains B, C)
MQSPPGKPEIHKCRSPDKETFTCWWNPGTDGGLPTNYSLTYSKEGEKTTYECPDYKTSGP
NSCFFSKQYTSIWKIYIITVNATNQMGSSSSDPLYVDVTYIVEPEPPRNLTLEVKQLKDK
KTYLWVKWSPPTITDVKTGWFTMEYEIRLKPEEAEEWEIHFTGHQTQFKVFDLYPGQKYL
VQTRCKPDHGYWSRWSQESSVEMPNDFTLKDRSRSHHHHHH

Primary citation

Crystal structure of an affinity-matured prolactin complexed to its dimerized receptor reveals the topology of hormone binding site 2. Broutin, I., Jomain, J.B., Tallet, E. et al. J Biol Chem (2010) 285:8422-8433. DOI 10.1074/jbc.M109.089128 · PubMed

Other PDB entries of the same protein (UniProt P01236 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3N06 2.0 Å, A mutant human Prolactin receptor antagonist H27A in complex with the extracellular…
3NCE 2.0 Å, A mutant human Prolactin receptor antagonist H27A in complex with the mutant…
3MZG 2.1 Å, Crystal structure of a human prolactin receptor antagonist in complex with the…
3N0P 2.1 Å, A mutant human Prolactin receptor antagonist H30A in complex with the extracellular…
3NCB 2.1 Å, A mutant human Prolactin receptor antagonist H180A in complex with the extracellular…
3D48 2.5 Å, Crystal structure of a prolactin receptor antagonist bound to the extracellular domain…
3NCC 2.5 Å, A human Prolactin receptor antagonist in complex with the mutant extracellular domain…
2Q98 2.7 Å, X-ray structure of a prolactin antagonist
3NCF 2.8 Å, A mutant human Prolactin receptor antagonist H30A in complex with the mutant…
3NPZ 3.35 Å, Prolactin Receptor (PRLR) Complexed with the Natural Hormone (PRL)
1RW5 Solution structure of human prolactin

Browse structure collections

About this viewer

MolViewer shows 3EW3 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.