3G6D: Complex between CNTO607 Fab and IL-13

Crystal structure of the complex between CNTO607 Fab and IL-13. Determined by X-ray diffraction at 3.2 Å resolution. Released 7 Apr 2009.

Method: X-ray diffraction
Resolution: 3.2 Å
Organism: Homo sapiens
Chains: 3
Atoms: 4,059
Mol. weight: 59.67 kDa
Released: 7 Apr 2009

Explore 3G6D in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3G6D contains 15 α-helices and 48 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	5-7	3
α-helix	8-23	16
β-strand	33-35	3	13
α-helix	43-52	10
α-helix	61-70	10
β-strand	89-91	3	13
α-helix	92-105	14

Chain H: 6 helices, 23 β-strands

Element	Residues	Length	Sheet
β-strand	3-7	5	7
β-strand	11-12	2	8
β-strand	18-25	8	7
α-helix	29-31	3
β-strand	34-39	6	9
β-strand	46-51	6	9
β-strand	58-60	3	9
α-helix	62-64	3
β-strand	68-73	6	7
β-strand	78-83	6	7
α-helix	88-90	3
β-strand	92-98	7	9
α-helix	104-106	3
β-strand	111-112	2	9
β-strand	116-118	3	9
β-strand	119-120	2	8
β-strand	126	1	10
β-strand	129-136	8	11
β-strand	144-154	11	11
β-strand	155	1	10
β-strand	160-163	4	12
α-helix	164-166	3
β-strand	168	1	12
β-strand	173-174	2	11
α-helix	175-177	3
β-strand	178-179	2	11
β-strand	185-194	10	11
β-strand	204-209	6	12
β-strand	214-219	6	12

Chain L: 4 helices, 23 β-strands

Element	Residues	Length	Sheet
β-strand	5	1	1
β-strand	9-12	4	2
β-strand	18-23	6	1
α-helix	27-29	3
β-strand	33-37	5	2
β-strand	44-47	4	2
β-strand	48	1	3
β-strand	52	1	3
β-strand	61-66	6	1
β-strand	69-74	6	1
α-helix	79-81	3
β-strand	83-91	9	2
β-strand	95-98	4	2
β-strand	102-106	5	2
β-strand	112	1	4
β-strand	115-119	5	5
α-helix	123-127	5
β-strand	132-140	9	5
β-strand	141	1	4
β-strand	146-151	6	6
β-strand	155-156	2	6
β-strand	160-162	3	5
β-strand	166-167	2	5
β-strand	173-180	8	5
α-helix	183-188	6
β-strand	192-198	7	6
β-strand	201-207	7	6

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
CNTO607 Fab Light chain	L	protein	213	Homo sapiens
CNTO607 Fab Heavy chain	H	protein	229	Homo sapiens
Interleukin-13	A	protein	113	Homo sapiens	P35225 (AlphaFold model)

Sequence of entity 1 (L), FASTA

>3G6D_1 CNTO607 Fab Light chain (chains L)
SYELTQPPSVSVAPGQTARISCSGDNIGGTFVSWYQQKPGQAPVLVIYDDNDRPSGIPER
FSGSNSGNTATLTISGTQAEDEADYYCGTWDMVTNNVFGGGTKLTVLGQPKAAPSVTLFP
PSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLS
LTPEQWKSHRSYSCQVTHEGSTVEKTVAPTECS

Sequence of entity 2 (H), FASTA

>3G6D_2 CNTO607 Fab Heavy chain (chains H)
QVQLVESGGGLVQPGGSLRLSCAASGFTFNSYWINWVRQAPGKGLEWVSGIAYDSSNTLY
ADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARGLGAFHWDMQPDYWGQGTLVTV
SSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQ
SSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTH

Sequence of entity 3 (A), FASTA

>3G6D_3 Interleukin-13 (chains A)
MGPVPPSTALRELIEELVNITQNQKAPLCNGSMVWSINLTAGMYCAALESLINVSGCSAI
EKTQRMLSGFCPHKVSAGQFSSLHVRDTKIEVAQFVKDLLLHLKKLFREGRFN

Primary citation

Epitope mapping of anti-interleukin-13 neutralizing antibody CNTO607. Teplyakov, A., Obmolova, G., Wu, S.J. et al. J Mol Biol (2009) 389:115-123. DOI 10.1016/j.jmb.2009.03.076 · PubMed

Other PDB entries of the same protein (UniProt P35225 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3L5X 1.9 Å, Crystal structure of the complex between IL-13 and H2L6 FAB
4I77 1.9 Å, Lebrikizumab Fab bound to IL-13
5L6Y 1.99 Å, il13 in complex with tralokinumab
3L5W 2.0 Å, Crystal structure of the complex between IL-13 and C836 FAB
4PS4 2.8 Å, Crystal structure of the complex between IL-13 and M1295 FAB
3BPO 3.0 Å, Crystal structure of the IL13-IL4R-IL13Ra ternary complex
5E4E 3.0 Å, Engineered Interleukin-13 bound to receptor
3LB6 3.05 Å, The structure of IL-13 in complex with IL-13Ralpha2
8BLQ 3.97 Å, Cryo-EM structure of the CODV-IL13-RefAb triple complex
1GA3 NMR structure of interleukin-13
1IJZ Solution Structure of Human IL-13
1IK0 Solution Structure of Human IL-13

Browse structure collections

About this viewer

MolViewer shows 3G6D directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.