3IV1: Tumor susceptibility gene 101 protein
Coiled-coil domain of tumor susceptibility gene 101. Determined by X-ray diffraction at 2.5 Å resolution. Released 3 Nov 2009.
- Method
- X-ray diffraction
- Resolution
- 2.5 Å
- Organism
- Homo sapiens
- Chains
- 8
- Atoms
- 5,199
- Mol. weight
- 74.07 kDa
- Released
- 3 Nov 2009
Explore 3IV1 in 3D
Show helices and sheets
RCSB PDB
PDBe
Secondary structure: helices and β-sheets
3IV1 contains 8 α-helices and 0 β-strands across 8 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
Chains A, B, C, D, E, F, G and H: 1 helix, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 230-299 | 70 | |
Molecules and chains
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|
| Tumor susceptibility gene 101 protein | A, B, C, D, E, F, G, H | protein | 78 | Homo sapiens | Q99816 (AlphaFold model) |
Sequence of entity 1 (A, B, C, D, E, F, G, H), FASTA
>3IV1_1 Tumor susceptibility gene 101 protein (chains A, B, C, D, E, F, G, H)
GSSLISAVSDKLRWRMKEEMDRAQAELNALKRTEEDLKKGHQKLEEMVTRLDQEVAEVDK
NIELLKKKDEELSSALEK
Primary citation
Coiled-Coil Domain of Human Tsg101. Neculai, D., Avvakumov, G.V., Wernimont, A.K. et al. To be published.
Other PDB entries of the same protein (UniProt Q99816 (AlphaFold model), which also has an AlphaFold model), best resolution first:
- 7NLC 1.4 Å, Crystallographic structure of human Tsg101 UEV domain in complex with a HEV ORF3 peptide
- 3OBQ 1.4 Å, Crystal Structure of the Tsg101 UEV domain in complex with a human HRS PSAP peptide
- 3OBS 1.5 Å, Crystal structure of Tsg101 UEV domain
- 3OBU 1.6 Å, Crystal structure of the Tsg101 UEV domain in complex with a HIV-1 PTAP peptide
- 3OBX 1.6 Å, Crystal structure of the Tsg101 UEV domain in complex with a HIV-1 Gag P7A mutant peptide
- 3P9G 1.8 Å, Crystal structure of the TSG101 UEV domain in complex with FA459 peptide
- 3P9H 1.8 Å, Crystal structure of the TSG101 UEV domain in complex with FA258 peptide
- 1S1Q 2.0 Å, TSG101(UEV) domain in complex with Ubiquitin
- 4YC1 2.0 Å, Structure of the human TSG101-UEV domain in the P321 space group
- 6VME 2.19 Å, Human ESCRT-I heterotetramer headpiece
- 4EJE 2.2 Å, Structure Of The Tsg101 UEV Domain In Complex With an Ebola PTAP late Domain Peptide
- 7ZLX 2.25 Å, Crystal Structure of the TSG101-UEV domain:space group P21
Browse structure collections
About this viewer
MolViewer shows 3IV1 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.