3L5W: Complex between IL-13 and C836 FAB

Crystal structure of the complex between IL-13 and C836 FAB. Determined by X-ray diffraction at 2.0 Å resolution. Released 14 Apr 2010.

Method: X-ray diffraction
Resolution: 2.0 Å
Organisms: Mus musculus, Homo sapiens
Chains: 6
Atoms: 8,510
Mol. weight: 121.64 kDa
Released: 14 Apr 2010

Explore 3L5W in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3L5W contains 43 α-helices and 96 β-strands across 6 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 8 helices, 23 β-strands

Element	Residues	Length	Sheet
β-strand	4-7	4	13
β-strand	10-13	4	14
β-strand	19-25	7	13
β-strand	29	1	15
β-strand	31	1	15
β-strand	33-38	6	14
β-strand	45-49	5	14
β-strand	53-54	2	14
α-helix	55	1
β-strand	62-67	6	13
β-strand	70-75	6	13
α-helix	80-82	3
β-strand	84-90	7	14
α-helix	96	1
β-strand	97-98	2	14
β-strand	102-106	5	14
β-strand	111	1	16
α-helix	112-113	2
β-strand	114-118	5	17
α-helix	119-121	3
α-helix	122-125	4
β-strand	129-139	11	17
β-strand	140	1	16
β-strand	145-150	6	18
β-strand	153-155	3	18
β-strand	159-163	5	17
α-helix	164-167	4
β-strand	173-182	10	17
α-helix	183-187	5
β-strand	191-197	7	18
β-strand	205-210	6	18

Chain B: 9 helices, 23 β-strands

Element	Residues	Length	Sheet
β-strand	3-7	5	19
β-strand	11-12	2	20
α-helix	17	1
β-strand	18-25	8	19
β-strand	35-41	7	14
β-strand	48-54	7	14
β-strand	59-61	3	14
α-helix	66-68	3
β-strand	69-73	5	19
β-strand	79-84	6	19
α-helix	89-91	3
β-strand	93-100	8	14
β-strand	108-111	4	14
β-strand	115-117	3	14
β-strand	118-119	2	20
α-helix	123-124	2
β-strand	125	1	21
α-helix	126-127	2
β-strand	128-132	5	22
β-strand	143-153	11	22
β-strand	154	1	21
β-strand	159-162	4	23
α-helix	163-165	3
β-strand	167	1	23
β-strand	171-173	3	22
α-helix	174-176	3
β-strand	177-178	2	22
β-strand	184-193	10	22
α-helix	194-198	5
β-strand	203-208	6	23
α-helix	209-211	3
β-strand	213-218	6	23

Chain H: 8 helices, 23 β-strands

Element	Residues	Length	Sheet
β-strand	3-7	5	7
β-strand	11-12	2	8
β-strand	18-25	8	7
β-strand	35-41	7	2
β-strand	48-54	7	2
β-strand	59-61	3	2
α-helix	66-68	3
β-strand	69-73	5	7
β-strand	79-84	6	7
α-helix	89-91	3
β-strand	93-100	8	2
β-strand	108-111	4	2
β-strand	115-117	3	2
β-strand	118-119	2	8
α-helix	123-124	2
β-strand	125	1	9
α-helix	126-127	2
β-strand	128-132	5	10
β-strand	139	1	10
β-strand	143-153	11	10
β-strand	154	1	9
β-strand	159-162	4	11
α-helix	163-165	3
β-strand	171-173	3	10
α-helix	174-176	3
β-strand	177-178	2	10
β-strand	184-193	10	10
α-helix	194-196	3
β-strand	203-208	6	11
α-helix	209-211	3
β-strand	213-218	6	11

Chain I: 5 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	8-21	14
β-strand	33-35	3	12
α-helix	43-51	9
α-helix	58-60	3
α-helix	61-68	8
β-strand	89-91	3	12
α-helix	92-109	18

Chain J: 5 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	8-21	14
β-strand	33-34	2	24
α-helix	44-51	8
α-helix	58-60	3
α-helix	61-67	7
β-strand	90-91	2	24
α-helix	92-109	18

Chain L: 8 helices, 23 β-strands

Element	Residues	Length	Sheet
β-strand	4-5	2	1
β-strand	10-13	4	2
β-strand	19-25	7	1
β-strand	29	1	3
β-strand	31	1	3
β-strand	33-38	6	2
β-strand	45-49	5	2
β-strand	53-54	2	2
α-helix	55	1
β-strand	62-67	6	1
β-strand	70-75	6	1
α-helix	80-82	3
β-strand	84-90	7	2
α-helix	96	1
β-strand	97-98	2	2
β-strand	102-106	5	2
β-strand	111	1	4
α-helix	112-113	2
β-strand	114-118	5	5
α-helix	119-121	3
α-helix	122-126	5
β-strand	129-139	11	5
β-strand	140	1	4
β-strand	145-150	6	6
β-strand	153-155	3	6
β-strand	159-163	5	5
α-helix	164-167	4
β-strand	173-182	10	5
α-helix	183-186	4
β-strand	191-197	7	6
β-strand	205-210	6	6

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
C836 light chain	A, L	protein	214	Mus musculus, Homo sapiens
C836 heavy chain	B, H	protein	230	Mus musculus, Homo sapiens
Interleukin-13	I, J	protein	113	Homo sapiens	P35225 (AlphaFold model)

Sequence of entity 1 (A, L), FASTA

>3L5W_1 C836 LIGHT CHAIN (chains A, L)
DVQITQSPSYLAASPGETITLNCRASKSISKYLAWYQEKPGKTNKLLIYSGSTLQSGIPS
RFSGSGSGTDFTLTISSLEPEDFAMYFCQQHNEYPYTFGGGTKLEIKRTVAAPSVFIFPP
SDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLT
LSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC

Sequence of entity 2 (B, H), FASTA

>3L5W_2 C836 HEAVY CHAIN (chains B, H)
QVTLKESGPGILQPSQTLSLTCSFSGFSLSTYGMGVGWIRQPSGKGLEWLAHIWWDDVKR
YNPALKSRLTISKDTSGSQVFLKIASVDTSDTATYYCARMGSDYDVWFDYWGQGTLVTVS
AASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQS
SGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCHHHHHH

Sequence of entity 3 (I, J), FASTA

>3L5W_3 Interleukin-13 (chains I, J)
MGPVPPSTALRELIEELVNITQNQKAPLCNGSMVWSINLTAGMYCAALESLINVSGCSAI
EKTQRMLSGFCPHKVSAGQFSSLHVRDTKIEVAQFVKDLLLHLKKLFREGRFN

Primary citation

Human framework adaptation of a mouse anti-human IL-13 antibody. Fransson, J., Teplyakov, A., Raghunathan, G. et al. J Mol Biol (2010) 398:214-231. DOI 10.1016/j.jmb.2010.03.004 · PubMed

Other PDB entries of the same protein (UniProt P35225 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3L5X 1.9 Å, Crystal structure of the complex between IL-13 and H2L6 FAB
4I77 1.9 Å, Lebrikizumab Fab bound to IL-13
5L6Y 1.99 Å, il13 in complex with tralokinumab
4PS4 2.8 Å, Crystal structure of the complex between IL-13 and M1295 FAB
3BPO 3.0 Å, Crystal structure of the IL13-IL4R-IL13Ra ternary complex
5E4E 3.0 Å, Engineered Interleukin-13 bound to receptor
3LB6 3.05 Å, The structure of IL-13 in complex with IL-13Ralpha2
3G6D 3.2 Å, Crystal structure of the complex between CNTO607 Fab and IL-13
8BLQ 3.97 Å, Cryo-EM structure of the CODV-IL13-RefAb triple complex
1GA3 NMR structure of interleukin-13
1IJZ Solution Structure of Human IL-13
1IK0 Solution Structure of Human IL-13

Browse structure collections

About this viewer

MolViewer shows 3L5W directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.