3LGO: Gse1p, member of the GSE/EGO complex

Structure of Gse1p, member of the GSE/EGO complex. Determined by X-ray diffraction at 2.85 Å resolution. Released 4 Aug 2010.

Method: X-ray diffraction
Resolution: 2.85 Å
Organism: Saccharomyces cerevisiae
Chains: 1
Atoms: 1,094
Mol. weight: 19.56 kDa
Released: 4 Aug 2010

Explore 3LGO in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3LGO contains 3 α-helices and 8 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 8 β-strands

Element	Residues	Length	Sheet
α-helix	7-15	9
β-strand	34-39	6	1
β-strand	45-49	5	1
α-helix	66-81	16
β-strand	95	1	1
β-strand	98-100	3	2
β-strand	103-105	3	2
β-strand	107-111	5	1
β-strand	116-121	6	1
β-strand	127-133	7	1
α-helix	139-155	17

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Protein SLM4	A	protein	172	Saccharomyces cerevisiae	P38247 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>3LGO_1 Protein SLM4 (chains A)
MGSSHHHHHHMVMLHSKNVKGFLENTLKPYDLHSVDFKTSSLQSSMIITATNGGILSYAT
SNNDVPKNSINEINSVNNLKMMSLLIKDKWSEDENDTEEQHSNSCYPVEIDSFKTKIYTY
EMEDLHTCVAQIPNSDLLLLFIAEGSFPYGLLVIKIERAMRELTDLFGYKLG

Primary citation

Structural conservation of components in the amino acid sensing branch of the TOR pathway in yeast and mammals. Kogan, K., Spear, E.D., Kaiser, C.A. et al. J Mol Biol (2010) 402:388-398. DOI 10.1016/j.jmb.2010.07.034 · PubMed

Other PDB entries of the same protein (UniProt P38247 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4FTX 2.1 Å, Crystal structure of Ego3 homodimer
4XPM 2.4 Å, Crystal structure of EGO-TC
4FUW 2.6 Å, Crystal structure of Ego3 mutant
9H4Q 3.1 Å, Cryo-EM structure of the SEAC wing - EGOC
6JWP 3.2 Å, crystal structure of EGOC
9H5K 3.2 Å, Cryo-EM structure of the SEAC-EGOC supercomplex

Browse structure collections

About this viewer

MolViewer shows 3LGO directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.