4FTX: Ego3 homodimer

Crystal structure of Ego3 homodimer. Determined by X-ray diffraction at 2.1 Å resolution. Released 28 Nov 2012.

Method: X-ray diffraction
Resolution: 2.1 Å
Organism: Saccharomyces cerevisiae
Chains: 2
Atoms: 2,633
Mol. weight: 39 kDa
Ligands: SIN
Released: 28 Nov 2012

Explore 4FTX in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4FTX contains 12 α-helices and 12 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 6 helices, 6 β-strands

Element	Residues	Length	Sheet
α-helix	9-17	9
α-helix	22-24	3
β-strand	34-39	6	1
β-strand	45-50	6	1
α-helix	59-84	26
β-strand	94-100	7	1
β-strand	103-112	10	1
β-strand	115-121	7	1
α-helix	122	1
β-strand	127-134	8	1
α-helix	139-150	12
α-helix	151-156	6

Chain B: 6 helices, 6 β-strands

Element	Residues	Length	Sheet
α-helix	9-16	8
α-helix	22-24	3
β-strand	34-39	6	1
β-strand	45-50	6	1
α-helix	59-84	26
β-strand	94-100	7	1
β-strand	103-112	10	1
β-strand	115-121	7	1
α-helix	122	1
β-strand	127-133	7	1
α-helix	139-150	12
α-helix	151-156	6

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Protein SLM4	A, B	protein	170	Saccharomyces cerevisiae	P38247 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>4FTX_1 Protein SLM4 (chains A, B)
MVMLHSKNVKGFLENTLKPYDLHSVDFKTSSLQSSMIITATNGGILSYATSNNDVPKNSI
NEINSVNNLKMMSLLIKDKWSEDENDTEEQHSNSCYPVEIDSFKTKIYTYEMEDLHTCVA
QIPNSDLLLLFIAEGSFPYGLLVIKIERAMRELTDLFGYKLGLEHHHHHH

Ligands and cofactors

ID	Name	Formula	Copies
SIN	Succinic acid	C4 H6 O4	1

Primary citation

Ego3 functions as a homodimer to mediate the interaction between Gtr1-Gtr2 and Ego1 in the ego complex to activate TORC1. Zhang, T., Peli-Gulli, M.P., Yang, H. et al. Structure (2012) 20:2151-2160. DOI 10.1016/j.str.2012.09.019 · PubMed

Other PDB entries of the same protein (UniProt P38247 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4XPM 2.4 Å, Crystal structure of EGO-TC
4FUW 2.6 Å, Crystal structure of Ego3 mutant
3LGO 2.85 Å, Structure of Gse1p, member of the GSE/EGO complex
9H4Q 3.1 Å, Cryo-EM structure of the SEAC wing - EGOC
6JWP 3.2 Å, crystal structure of EGOC
9H5K 3.2 Å, Cryo-EM structure of the SEAC-EGOC supercomplex

Browse structure collections

About this viewer

MolViewer shows 4FTX directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.