4FUW: Ego3 mutant

Crystal structure of Ego3 mutant. Determined by X-ray diffraction at 2.6 Å resolution. Released 28 Nov 2012.

Method: X-ray diffraction
Resolution: 2.6 Å
Organism: Saccharomyces cerevisiae
Chains: 2
Atoms: 2,310
Mol. weight: 37.12 kDa
Released: 28 Nov 2012

Explore 4FUW in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4FUW contains 10 α-helices and 12 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 6 β-strands

Element	Residues	Length	Sheet
α-helix	9-17	9
α-helix	19-23	5
β-strand	25-30	6	1
β-strand	36-41	6	1
α-helix	50-75	26
β-strand	86-91	6	1
β-strand	94-102	9	1
β-strand	107-112	6	1
β-strand	118-124	7	1
α-helix	130-142	13
α-helix	145-147	3

Chain B: 5 helices, 6 β-strands

Element	Residues	Length	Sheet
α-helix	9-17	9
α-helix	19-20	2
β-strand	25-30	6	2
β-strand	36-41	6	2
α-helix	50-76	27
β-strand	85-91	7	2
β-strand	94-103	10	2
β-strand	106-112	7	2
β-strand	118-124	7	2
α-helix	130-141	12
α-helix	145-147	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Protein SLM4	A, B	protein	161	Saccharomyces cerevisiae	P38247 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>4FUW_1 Protein SLM4 (chains A, B)
MVMLHSKNVKGFLENTLKPYGSLQSSMIITATNGGILSYATSNNDVPKNSINEINSVNNL
KMMSLLIKDKWSEDENDTEEQHSNSCYPVEIDSFKTKIYTYEMEDLHTCVAQIPNSDLLL
LFIAEGSFPYGLLVIKIERAMRELTDLFGYKLGLEHHHHHH

Primary citation

Ego3 functions as a homodimer to mediate the interaction between Gtr1-Gtr2 and Ego1 in the ego complex to activate TORC1. Zhang, T., Peli-Gulli, M.P., Yang, H. et al. Structure (2012) 20:2151-2160. DOI 10.1016/j.str.2012.09.019 · PubMed

Other PDB entries of the same protein (UniProt P38247 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4FTX 2.1 Å, Crystal structure of Ego3 homodimer
4XPM 2.4 Å, Crystal structure of EGO-TC
3LGO 2.85 Å, Structure of Gse1p, member of the GSE/EGO complex
9H4Q 3.1 Å, Cryo-EM structure of the SEAC wing - EGOC
6JWP 3.2 Å, crystal structure of EGOC
9H5K 3.2 Å, Cryo-EM structure of the SEAC-EGOC supercomplex

Browse structure collections

About this viewer

MolViewer shows 4FUW directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.