3MFK: Ets1 complex with stromelysin-1 promoter DNA

Ets1 complex with stromelysin-1 promoter DNA. Determined by X-ray diffraction at 3.0 Å resolution. Released 18 Aug 2010.

Method: X-ray diffraction
Resolution: 3.0 Å
Organism: Homo sapiens
Chains: 4
Atoms: 2,924
Mol. weight: 47.26 kDa
Released: 18 Aug 2010

Explore 3MFK in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3MFK contains 16 α-helices and 8 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 9 helices, 4 β-strands

Element	Residues	Length	Sheet
α-helix	304-312	9
α-helix	323-330	8
α-helix	337-345	9
α-helix	348-352	5
β-strand	355-356	2	1
β-strand	362-364	3	1
α-helix	368-378	11
α-helix	386-394	9
α-helix	396-399	4
β-strand	404	1	1
β-strand	411-413	3	1
α-helix	418-422	5
α-helix	426-432	7

Chain B: 7 helices, 4 β-strands

Element	Residues	Length	Sheet
α-helix	304-312	9
α-helix	323-330	8
α-helix	337-344	8
β-strand	355-356	2	2
β-strand	362-364	3	2
α-helix	368-378	11
α-helix	386-399	14
β-strand	402-404	3	2
β-strand	411-414	4	2
α-helix	418-422	5
α-helix	426-433	8

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Protein C-ets-1	A, B	protein	162	Homo sapiens	P14921 (AlphaFold model)
stromelysin-1 promoter DNA	C	DNA	16
stromelysin-1 promoter DNA	D	DNA	16

Sequence of entity 1 (A, B), FASTA

>3MFK_1 Protein C-ets-1 (chains A, B)
VPSYDSFDSEDYPAALPNHKPKGTFKDYVRDRADLNKDKPVIPAAALAGYTGSGPIQLWQ
FLLELLTDKSCQSFISWTGDGWEFKLSDPDEVARRWGKRKNKPKMNYEKLSRGLRYYYDK
NIIHKTAGKRYVYRFVCDLQSLLGYTPEELHAMLDVKPDADE

Sequence of entity 2 (C), FASTA

>3MFK_2 stromelysin-1 promoter DNA (chains C)
GCAGGAAGTGCTTCCT

Sequence of entity 3 (D), FASTA

>3MFK_3 stromelysin-1 promoter DNA (chains D)
CAGGAAGCACTTCCTG

Primary citation

Structural basis of Ets1 cooperative binding to palindromic sequences on stromelysin-1 promoter DNA. Babayeva, N.D., Wilder, P.J., Shiina, M. et al. Cell Cycle (2010) 9:3054-3062. PubMed

Other PDB entries of the same protein (UniProt P14921 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1GVJ 1.53 Å, Ets-1 DNA binding and autoinhibitory domains
4LG0 2.19 Å, Structure of a ternary FOXO1-ETS1 DNA complex
4L18 2.3 Å, Crystal structure of Runx1 and Ets1 bound to TCR alpha promoter (crystal form 3)
3WTS 2.35 Å, Crystal structure of the complex comprised of ETS1, RUNX1, CBFBETA, and the tcralpha…
3WTT 2.35 Å, Crystal structure of the complex comprised of phosphorylated ETS1, RUNX1, CBFBETA, and…
3WU1 2.4 Å, Crystal structure of the ETS1-RUNX1-DNA ternary complex
4L0Y 2.5 Å, Crystal structure of Runx1 and Ets1 bound to TCR alpha promoter (crystal form 1)
2NNY 2.58 Å, Crystal structure of the Ets1 dimer DNA complex.
3WU0 2.6 Å, Crystal structure of phosphorylated ETS-1 DNA binding and autoinhibitory domains (276-441)
3WTZ 2.61 Å, Crystal structure of ETS-1 DNA binding and autoinhibitory domains (276-441)
3WTU 2.7 Å, Crystal structure of the complex comprised of ETS1 (V170A), RUNX1, CBFBETA, and the…
3WTV 2.7 Å, Crystal structure of the complex comprised of ETS1(V170G), RUNX1, CBFBETA, and the…

Browse structure collections

About this viewer

MolViewer shows 3MFK directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.