3MP9: Streptococcal protein G B1 domain at pH 3.0

Structure of Streptococcal protein G B1 domain at pH 3.0. Determined by X-ray diffraction at 1.2 Å resolution. Released 23 Feb 2011.

Method: X-ray diffraction
Resolution: 1.2 Å
Organism: Streptococcus sp. 'group G'
Chains: 2
Atoms: 1,087
Mol. weight: 14.53 kDa
Released: 23 Feb 2011

Explore 3MP9 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3MP9 contains 2 α-helices and 8 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A and B: 1 helix, 4 β-strands

Element	Residues	Length	Sheet
β-strand	9-16	8	1
β-strand	21-28	8	1
α-helix	31-44	14
β-strand	50-54	5	1
β-strand	59-63	5	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Immunoglobulin G-binding protein G	A, B	protein	64	Streptococcus sp. 'group G'	P06654 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>3MP9_1 Immunoglobulin G-binding protein G (chains A, B)
HHHHHHAMDTYKLILNGKTLKGETTTEAVDAATAEKVFKQYANDNGVDGEWTYDDATKTF
TVTE

Primary citation

Structural origins of pH-dependent chemical shifts in the B1 domain of protein G. Tomlinson, J.H., Green, V.L., Baker, P.J. et al. Proteins (2010) 78:3000-3016. DOI 10.1002/prot.22825 · PubMed

Other PDB entries of the same protein (UniProt P06654 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1IGD 1.1 Å, The third IgG-binding domain from streptococcal protein G: an analysis by X-ray…
2IGD 1.1 Å, Anisotropic structure of protein G IgG-binding domain III at 1.1 Å resolution
6CNE 1.2 Å, Selenomethionine variant (V29SeM) of protein GB1
1PGX 1.66 Å, The 1.66 Å X-ray structure of the B2 immunoglobulin-binding domain of streptococcal…
6L9D 1.73 Å, X-ray structure of synthetic GB1 domain with mutations K10(DVA), T11S
6L91 1.84 Å, X-ray structure of synthetic GB1 domain with the mutation K10(DVA).
6LJI 1.84 Å, X-ray structure of synthetic GB1 domain with mutations K10(DVA), T11V
1PGB 1.92 Å, Two crystal structures of the B1 immunoglobulin-binding domain of streptoccocal protein…
4KGS 1.95 Å, Backbone Modifications in the Protein GB1 Loops: beta-3-Val21, beta-3-Asp40
6L9B 1.95 Å, X-ray structure of synthetic GB1 domain with mutations K10(DVA), T11A
1EM7 2.0 Å, Helix variant of the B1 domain from streptococcal protein G
4KGR 2.0 Å, Backbone Modifications in the Protein GB1 Helix: beta-3-Ala24, beta-3-Lys28,…

Browse structure collections

About this viewer

MolViewer shows 3MP9 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.