3N1M: IhhN

Crystal Structure of IhhN bound to BOCFn3. Determined by X-ray diffraction at 1.69 Å resolution. Released 2 Jun 2010.

Method: X-ray diffraction
Resolution: 1.69 Å
Organism: Homo sapiens
Chains: 2
Atoms: 2,476
Mol. weight: 32 kDa
Ligands: CA, ZN
Released: 2 Jun 2010

Explore 3N1M in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3N1M contains 14 α-helices and 16 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain B: 9 helices, 8 β-strands

Element	Residues	Length	Sheet
α-helix	40-43	4
α-helix	46-48	3
β-strand	52-53	2	1
α-helix	77-80	4
β-strand	82-83	2	2
β-strand	89-91	3	1
α-helix	99-101	3
β-strand	102-103	2	2
α-helix	105-121	17
β-strand	127-131	5	1
α-helix	140	1
α-helix	144-147	4
β-strand	150-155	6	1
α-helix	160-162	3
α-helix	163-172	10
β-strand	177-182	6	1
β-strand	185-189	5	1

Chain C: 5 helices, 8 β-strands

Element	Residues	Length	Sheet
β-strand	717-725	9	3
β-strand	728-734	7	3
α-helix	737-740	4
β-strand	747-754	8	4
α-helix	760-762	3
β-strand	764-769	6	4
β-strand	774-777	4	3
α-helix	780-781	2
β-strand	785-794	10	4
β-strand	797-798	2	4
α-helix	799-801	3
β-strand	805-808	4	4
α-helix	809-812	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Indian hedgehog protein	B	protein	169	Homo sapiens	Q14623 (AlphaFold model)
Brother of CDO	C	protein	111	Homo sapiens	Q9BWV1 (AlphaFold model)

Sequence of entity 1 (B), FASTA

>3N1M_1 Indian hedgehog protein (chains B)
GSGPGPGRVVGSRRRPPRKLVPLAYKQFSPNVPEKTLGASGRYEGKIARSSERFKELTPN
YNPDIIFKDEENTGADRLMTQRCKDRLNSLAISVMNQWPGVKLRVTEGWDEDGHHSEESL
HYEGRAVDITTSDRDRNKYGLLARLAVEAGFDWVYYESKAHVHCSVKSE

Sequence of entity 2 (C), FASTA

>3N1M_2 Brother of CDO (chains C)
GSTERPVAGPYITFTDAVNETTIMLKWMYIPASNNNTPIHGFYIYYRPTDSDNDSDYKKD
MVEGDKYWHSISHLQPETSYDIKMQCFNEGGESEFSNVMICETKARKSSGQ

Ligands and cofactors

ID	Name	Formula	Copies
CA	Calcium ion	Ca	2
ZN	Zinc ion	Zn	1

Primary citation

All mammalian Hedgehog proteins interact with cell adhesion molecule, down-regulated by oncogenes (CDO) and brother of CDO (BOC) in a conserved manner. Kavran, J.M., Ward, M.D., Oladosu, O.O. et al. J Biol Chem (2010) 285:24584-24590. DOI 10.1074/jbc.M110.131680 · PubMed

Other PDB entries of the same protein (UniProt Q14623 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3K7I 1.44 Å, Crystal structure of the E131K mutant of the Indian Hedgehog N-terminal signalling domain
3K7G 1.5 Å, Crystal structure of the Indian Hedgehog N-terminal signalling domain
3K7H 1.5 Å, Crystal structure of the E95K mutant of the Indian Hedgehog N-terminal signalling domain
3N1F 1.6 Å, Crystal Structure of IhhN bound to CDOFn3
3K7J 1.9 Å, Crystal structure of the D100E mutant of the Indian Hedgehog N-terminal signalling domain
3N1O 2.55 Å, Crystal structure of IhhN
3N1P 2.7 Å, Crystal Structure of IhhN bound to BOCFn3

Browse structure collections

About this viewer

MolViewer shows 3N1M directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.