3OG5: BamA POTRA45 tandem

Crystal Structure of BamA POTRA45 tandem. Determined by X-ray diffraction at 2.69 Å resolution. Released 17 Nov 2010.

Method: X-ray diffraction
Resolution: 2.69 Å
Organism: Escherichia coli
Chains: 2
Atoms: 2,351
Mol. weight: 37.87 kDa
Released: 17 Nov 2010

Explore 3OG5 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3OG5 contains 13 α-helices and 17 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 9 helices, 8 β-strands

Element	Residues	Length	Sheet
β-strand	267-276	10	1
α-helix	281-288	8
α-helix	289-291	3
α-helix	294	1
β-strand	295	1	1
α-helix	296	1
α-helix	298-313	16
β-strand	321-329	9	1
β-strand	334-342	9	1
β-strand	348-355	8	2
α-helix	362-366	5
β-strand	376	1	2
α-helix	377	1
α-helix	379-390	12
β-strand	395-404	10	2
α-helix	405	1
β-strand	411-420	10	2

Chain B: 4 helices, 9 β-strands

Element	Residues	Length	Sheet
β-strand	267	1	3
β-strand	273-276	4	4
α-helix	281-287	7
β-strand	295	1	3
α-helix	298-312	15
β-strand	321-324	4	4
β-strand	339-342	4	4
β-strand	348-355	8	5
α-helix	365-368	4
β-strand	376	1	5
α-helix	379-389	11
β-strand	397-404	8	5
β-strand	411-419	9	5

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Outer membrane protein assembly complex, YaeT protein	A, B	protein	166	Escherichia coli	P0A940 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>3OG5_1 Outer membrane protein assembly complex, YaeT protein (chains A, B)
GAMDQYKLSGVEVSGNLAGHSAEIEQLTKIEPGELYNGTKVTKMEDDIKKLLGRYGYAYP
RVQSMPEINDADKTVKLRVNVDAGNRFYVRKIRFEGNDTSKDAVLRREMRQMEGAWLGSD
LVDQGKERLNRLGFFETVDTDTQRVPGSPDQVDVVYKVKERNTGPG

Primary citation

Structure and Flexibility of the Complete Periplasmic Domain of BamA: The Protein Insertion Machine of the Outer Membrane. Gatzeva-Topalova, P.Z., Warner, L.R., Pardi, A. et al. Structure (2010) 18:1492-1501. DOI 10.1016/j.str.2010.08.012 · PubMed

Other PDB entries of the same protein (UniProt P0A940 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3Q6B 1.5 Å, The high-resolution and new form crystal structure of BamA POTRA4-5 from E.coli
9CS2 1.78 Å, E. coli BamA beta-barrel bound to cyclic peptide CP3
6QGW 1.94 Å, Crystal structure of E.coli BamA beta-barrel in complex with nanobody E6
9CS0 1.94 Å, E. coli BamA beta-barrel bound to darobactin and cyclic peptide CP1
9CS1 2.15 Å, E. coli BamA beta-barrel bound to darobactin and cyclic peptide CP2
4XGA 2.15 Å, Crystal structure of BamB and BamA P3-5 complex from E.coli
2QDF 2.2 Å, Structure of N-terminal domain of E. Coli YaeT
6QGX 2.2 Å, Crystal structure of E.coli BamA beta-barrel in complex with nanobody F7
7NRF 2.2 Å, Crystal structure of E.coli BamA beta-barrel in complex with darobactin (crystal form 2)
7NRE 2.3 Å, Crystal structure of E.coli BamA beta-barrel in complex with darobactin (crystal form 1)
7P1C 2.5 Å, Crystal structure of E.coli BamA beta-barrel in complex with darobactin B
7R1V 2.5 Å, Crystal structure of E.coli BamA beta-barrel in complex with dynobactin A

Browse structure collections

About this viewer

MolViewer shows 3OG5 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.