3PB1: Plasminogen activator inhibitor 1

Crystal Structure of a Michaelis Complex between Plasminogen Activator Inhibitor-1 and Urokinase-type Plasminogen Activator. Determined by X-ray diffraction at 2.3 Å resolution. Released 29 Dec 2010.

Method: X-ray diffraction
Resolution: 2.3 Å
Organism: Homo sapiens
Chains: 2
Atoms: 5,250
Mol. weight: 71.41 kDa
Released: 29 Dec 2010

Explore 3PB1 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3PB1 contains 29 α-helices and 41 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain E: 12 helices, 24 β-strands

Element	Residues	Length	Sheet
β-strand	17	1	5
β-strand	20-21	2	4
α-helix	24-26	3
β-strand	30-36	7	6
α-helix	37	1
β-strand	38-48	11	6
β-strand	51-54	4	6
α-helix	56-58	3
α-helix	62-63	3
β-strand	64-68	5	6
β-strand	72	1	7
β-strand	81-90	10	6
β-strand	95-96	2	8
β-strand	99-100	2	8
β-strand	104-109	6	6
β-strand	115	1	9
β-strand	118	1	9
α-helix	120-121	2
β-strand	122	1	4
α-helix	123-125	3
α-helix	130-131	2
β-strand	135-140	6	4
α-helix	151-152	2
β-strand	154	1	7
β-strand	156-163	8	4
α-helix	165-168	4
α-helix	173-175	3
β-strand	180-184	5	4
β-strand	189	1	5
β-strand	198-203	6	4
β-strand	206-215	10	4
β-strand	222	1	10
β-strand	224	1	10
β-strand	226-230	5	4
α-helix	231-233	3
α-helix	235-241	7

Chain I: 17 helices, 17 β-strands

Element	Residues	Length	Sheet
α-helix	6-25	20
β-strand	32-34	3	1
α-helix	36-47	12
α-helix	52-62	11
α-helix	71-82	12
β-strand	91-100	10	2
α-helix	104-106	3
α-helix	109-117	9
α-helix	121	1
β-strand	122-124	3	2
α-helix	129-143	15
α-helix	153-156	4
β-strand	163-172	10	2
α-helix	173-174	2
β-strand	175	1	3
α-helix	178-180	3
α-helix	181-183	3
β-strand	185-190	6	1
β-strand	196-214	19	1
β-strand	220-227	8	1
β-strand	228	1	3
α-helix	229-231	3
β-strand	233-240	8	1
α-helix	248-251	4
α-helix	256-264	9
β-strand	267-276	10	1
β-strand	278-285	8	2
α-helix	287-292	6
α-helix	297-299	3
β-strand	319-328	10	2
β-strand	345	1	4
β-strand	351-353	3	1
β-strand	358-364	7	1
β-strand	369-376	8	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Plasminogen activator inhibitor 1	I	protein	379	Homo sapiens	P05121 (AlphaFold model)
Plasminogen activator, urokinase	E	protein	253	Homo sapiens	P00749 (AlphaFold model)

Sequence of entity 1 (I), FASTA

>3PB1_1 Plasminogen activator inhibitor 1 (chains I)
VHHPPSYVAHLASDFGVRVFQQVAQASKDRNVVFSPYGVASVLAMLQLTTGGETQQQIQA
AMGFKIDDKGMAPALRHLYKELMGPWNKDEISTTDAIFVQRDLKLVQGFMPHFFRLFRST
VKQVDFSEVERARFIINDWVKTHTKGMISHLLGTGAVQQLTRLVLVNALYFNGQWKTPFP
DSSTHRRLFHKSDGSTVSVPMMAQTNKFNYTEFTTPDGHYYDILELPYHGDTLSMFIAAP
YEKEVPLSALTNILSAQLISHWKGNMTRLPRLLVLPKFSLETEVDLRKPLENLGMTDMFR
QFQADFTSLSDQEPLHVALALQKVKIEVNESGTVASSSTAVIVSARMAPEEIIIDRPFLF
VVRHNPTGTVLFMGQVMEP

Sequence of entity 2 (E), FASTA

>3PB1_2 Plasminogen activator, urokinase (chains E)
IIGGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLISPCWVISATHCFIDYPKKEDYIVY
LGRSRLNSNTQGEMKFEVENLILHKDYSADTLAHHNDIALLKIRSKEGRCAQPSRTIQTI
ALPSMYNDPQFGTSCEITGFGKEQSTDYLYPEQLKMTVVKLISHRECQQPHYYGSEVTTK
MLCAADPQWKTDSCQGDAGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPW
IRSHTKEENGLAL

Primary citation

Structural basis for recognition of urokinase-type plasminogen activator by plasminogen activator inhibitor-1. Lin, Z., Jiang, L., Yuan, C. et al. J Biol Chem (2011) 286:7027-7032. DOI 10.1074/jbc.M110.204537 · PubMed

Other PDB entries of the same protein (UniProt P05121 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7AQF 1.77 Å, Crystal Structure of Small Molecule Inhibitor TM5484 Bound to Stabilized Active…
1LJ5 1.8 Å, 1.8A Resolution Structure of Latent Plasminogen Activator Inhibitor-1(PAI-1)
6ZRV 1.88 Å, Crystal Structure of Stabilized Active Plasminogen Activator Inhibitor-1 (PAI-1-W175F)…
1A7C 1.95 Å, Human plasminogen activator inhibitor type-1 in complex with a pentapeptide
3CVM 2.02 Å, High resolution structure of a stable Plasminogen activator inhibitor type-1 in its…
6GWN 2.03 Å, Crystal Structure of Stabilized Active Plasminogen Activator Inhibitor-1 (PAI-1-W175F)…
1DVN 2.1 Å, Latent form of plasminogen activator inhibitor-1 (pai-1)
4G8R 2.19 Å, Crystal Structure of a novel small molecule inactivator bound to plasminogen activator…
7AQG 2.27 Å, Crystal Structure of Small Molecule Inhibitor TM5484 Bound to Stabilized Active…
1OC0 2.28 Å, plasminogen activator inhibitor-1 complex with somatomedin B domain of vitronectin
6GWP 2.28 Å, Crystal Structure of Stabilized Active Plasminogen Activator Inhibitor-1 (PAI-1-stab) in…
3Q02 2.3 Å, Crystal structure of plasminogen activator inhibitor-1 in a metastable active…

Browse structure collections

About this viewer

MolViewer shows 3PB1 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.