3PS5: Tyrosine-protein phosphatase non-receptor type 6

Crystal structure of the full-length Human Protein Tyrosine Phosphatase SHP-1. Determined by X-ray diffraction at 3.1 Å resolution. Released 20 Apr 2011.

Method: X-ray diffraction
Resolution: 3.1 Å
Organism: Homo sapiens
Chains: 1
Atoms: 4,266
Mol. weight: 68.12 kDa
Released: 20 Apr 2011

Explore 3PS5 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3PS5 contains 23 α-helices and 36 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 23 helices, 36 β-strands

Element	Residues	Length	Sheet
α-helix	11-21	11
β-strand	27-31	5	1
β-strand	39-45	7	1
β-strand	48-54	7	1
β-strand	55-56	2	2
β-strand	61-62	2	2
β-strand	69	1	2
α-helix	72-80	9
β-strand	87	1	3
α-helix	92	1
β-strand	93	1	3
α-helix	94	1
β-strand	99	1	1
α-helix	101-104	4
β-strand	111-113	3	4
α-helix	117-127	11
β-strand	132-137	6	4
β-strand	142	1	5
β-strand	144	1	5
β-strand	145-154	10	4
α-helix	161	1
β-strand	162-169	8	4
β-strand	170	1	6
α-helix	172-174	3
β-strand	176	1	7
β-strand	177	1	6
β-strand	184	1	7
α-helix	187-196	10
β-strand	199	1	8
β-strand	207	1	8
β-strand	211-212	2	4
β-strand	218-219	2	9
α-helix	220-222	3
α-helix	223-231	9
α-helix	243-252	10
α-helix	253-257	5
α-helix	264-266	3
α-helix	268-273	6
β-strand	286-288	3	10
β-strand	301-308	8	10
β-strand	320-324	5	10
α-helix	325-328	4
α-helix	332-341	10
β-strand	346-349	4	10
β-strand	354	1	11
β-strand	359	1	11
α-helix	366-367	2
β-strand	368	1	10
β-strand	371-374	4	10
β-strand	377-386	10	10
β-strand	390-399	10	10
β-strand	407-414	8	10
α-helix	427-442	16
α-helix	448	1
β-strand	449-452	4	10
α-helix	458-476	19
β-strand	481-482	2	9
α-helix	484-492	9
α-helix	502-520	19

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Tyrosine-protein phosphatase non-receptor type 6	A	protein	595	Homo sapiens	P29350 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>3PS5_1 Tyrosine-protein phosphatase non-receptor type 6 (chains A)
MVRWFHRDLSGLDAETLLKGRGVHGSFLARPSRKNQGDFSLSVRVGDQVTHIRIQNSGDF
YDLYGGEKFATLTELVEYYTQQQGVLQDRDGTIIHLKYPLNCSDPTSERWYHGHMSGGQA
ETLLQAKGEPWTFLVRESLSQPGDFVLSVLSDQPKAGPGSPLRVTHIKVMCEGGRYTVGG
LETFDSLTDLVEHFKKTGIEEASGAFVYLRQPYYATRVNAADIENRVLELNKKQESEDTA
KAGFWEEFESLQKQEVKNLHQRLEGQRPENKGKNRYKNILPFDHSRVILQGRDSNIPGSD
YINANYIKNQLLGPDENAKTYIASQGCLEATVNDFWQMAWQENSRVIVMTTREVEKGRNK
CVPYWPEVGMQRAYGPYSVTNCGEHDTTEYKLRTLQVSPLDNGDLIREIWHYQYLSWPDH
GVPSEPGGVLSFLDQINQRQESLPHAGPIIVHSSAGIGRTGTIIVIDMLMENISTKGLDC
DIDIQKTIQMVRAQRSGMVQTEAQYKFIYVAIAQFIETTKKKLEVLQSQKGQESEYGNIT
YPPAMKNAHAKASRTSSKHKEDVYENLHTKNKREEKVKKQRSADKEKSKGSLKRK

Primary citation

Crystal structure of human protein tyrosine phosphatase SHP-1 in the open conformation. Wang, W., Liu, L., Song, X. et al. J Cell Biochem (2011) 112:2062-2071. DOI 10.1002/jcb.23125 · PubMed

Other PDB entries of the same protein (UniProt P29350 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4GRZ 1.37 Å, Crystal structure of SHP1 catalytic domain with PO4
4HJP 1.4 Å, SHP-1 catalytic domain WPD loop open
4GRY 1.7 Å, Crystal structure of SHP1 catalytic domain with SO4
8YHI 1.75 Å, The Crystal Structure of SHP1 from Biortus.
4GS0 1.8 Å, Crystal structure of SHP1 catalytic domain with JAK1 activation loop peptide
4HJQ 1.8 Å, SHP-1 catalytic domain WPD loop closed
1FPR 2.5 Å, Crystal structure of the complex formed between the catalytic domain of shp-1 and an in…
1GWZ 2.5 Å, Crystal structure of the catalytic domain of the protein tyrosine phosphatase shp-1
6SM5 2.75 Å, MbC/SHP1-C-SH2 complex
2B3O 2.8 Å, Crystal structure of human tyrosine phosphatase SHP-1
1X6C Solution structures of the SH2 domain of human protein-tyrosine phosphatase SHP-1
2RMX Solution structure of the SHP-1 C-terminal SH2 domain complexed with a…

Browse structure collections

About this viewer

MolViewer shows 3PS5 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.