3Q6B: PDB entry 3Q6B

The high-resolution and new form crystal structure of BamA POTRA4-5 from E.coli. Determined by X-ray diffraction at 1.5 Å resolution. Released 10 Aug 2011.

Method: X-ray diffraction
Resolution: 1.5 Å
Organism: Escherichia coli
Chains: 1
Atoms: 1,422
Mol. weight: 21.35 kDa
Released: 10 Aug 2011

Explore 3Q6B in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3Q6B contains 8 α-helices and 8 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 8 helices, 8 β-strands

Element	Residues	Length	Sheet
β-strand	267-276	10	1
α-helix	281-287	7
α-helix	294	1
β-strand	295	1	1
α-helix	296	1
α-helix	298-313	16
β-strand	321-329	9	1
β-strand	334-342	9	1
β-strand	348-355	8	2
α-helix	362-366	5
α-helix	372	1
β-strand	376	1	2
α-helix	377	1
α-helix	379-392	14
β-strand	397-405	9	2
β-strand	408-419	12	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Outer membrane protein assembly complex, YaeT protein	A	protein	189	Escherichia coli	P0A940 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>3Q6B_1 Outer membrane protein assembly complex, YaeT protein (chains A)
MGSSHHHHHHSSGENLYFEGSHMASMTGGQQMGRYKLSGVEVSGNLAGHSAEIEQLTKIE
PGELYNGTKVTKMEDDIKKLLGRYGYAYPRVQSMPEINDADKTVKLRVNVDAGNRFYVRK
IRFEGNDTSKDAVLRREMRQMEGAWLGSDLVDQGKERLNRLGFFETVDTDTQRVPGSPDQ
VDVVYKVKE

Primary citation

High-resolution structure of a new crystal form of BamA POTRA4-5 from Escherichia coli. Zhang, H., Gao, Z.Q., Hou, H.F. et al. Acta Crystallogr Sect F Struct Biol Cryst Commun (2011) 67:734-738. DOI 10.1107/S1744309111014254 · PubMed

Other PDB entries of the same protein (UniProt P0A940 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9CS2 1.78 Å, E. coli BamA beta-barrel bound to cyclic peptide CP3
6QGW 1.94 Å, Crystal structure of E.coli BamA beta-barrel in complex with nanobody E6
9CS0 1.94 Å, E. coli BamA beta-barrel bound to darobactin and cyclic peptide CP1
9CS1 2.15 Å, E. coli BamA beta-barrel bound to darobactin and cyclic peptide CP2
4XGA 2.15 Å, Crystal structure of BamB and BamA P3-5 complex from E.coli
2QDF 2.2 Å, Structure of N-terminal domain of E. Coli YaeT
6QGX 2.2 Å, Crystal structure of E.coli BamA beta-barrel in complex with nanobody F7
7NRF 2.2 Å, Crystal structure of E.coli BamA beta-barrel in complex with darobactin (crystal form 2)
7NRE 2.3 Å, Crystal structure of E.coli BamA beta-barrel in complex with darobactin (crystal form 1)
7P1C 2.5 Å, Crystal structure of E.coli BamA beta-barrel in complex with darobactin B
7R1V 2.5 Å, Crystal structure of E.coli BamA beta-barrel in complex with dynobactin A
6QGY 2.51 Å, Crystal structure of E.coli BamA beta-barrel in complex with nanobody B12

Browse structure collections

About this viewer

MolViewer shows 3Q6B directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.