3R62: Complement regulator Factor H mutant, T1184R

Structure of complement regulator Factor H mutant, T1184R. Determined by X-ray diffraction at 1.52 Å resolution. Released 29 Jun 2011.

Method: X-ray diffraction
Resolution: 1.52 Å
Organism: Homo sapiens
Chains: 2
Atoms: 2,580
Mol. weight: 29.75 kDa
Released: 29 Jun 2011

Explore 3R62 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3R62 contains 14 α-helices and 41 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 7 helices, 21 β-strands

Element	Residues	Length	Sheet
β-strand	1109	1	1
α-helix	1112-1114	3
β-strand	1115	1	2
β-strand	1118-1120	3	2
β-strand	1128	1	1
β-strand	1133-1135	3	3
β-strand	1136-1138	3	2
β-strand	1143-1145	3	4
β-strand	1149-1151	3	3
β-strand	1152-1153	2	5
β-strand	1156-1157	2	5
α-helix	1158-1160	3
β-strand	1162-1164	3	4
α-helix	1165-1166	2
β-strand	1167-1168	2	6
α-helix	1171-1177	7
β-strand	1179-1181	3	7
β-strand	1190-1191	2	6
α-helix	1192	1
β-strand	1196-1198	3	8
β-strand	1199-1201	3	7
α-helix	1202	1
β-strand	1205-1207	3	9
α-helix	1212-1213	2
β-strand	1215-1217	3	8
β-strand	1219	1	10
β-strand	1222	1	10
β-strand	1228-1230	3	9

Chain B: 7 helices, 20 β-strands

Element	Residues	Length	Sheet
α-helix	1107-1108	2
β-strand	1109	1	11
α-helix	1112-1114	3
β-strand	1118-1120	3	12
α-helix	1123-1124	2
β-strand	1128	1	11
β-strand	1133-1135	3	13
β-strand	1136-1138	3	12
β-strand	1143-1145	3	14
β-strand	1149-1151	3	13
β-strand	1152-1153	2	15
β-strand	1156-1157	2	15
β-strand	1162-1164	3	14
α-helix	1165-1166	2
β-strand	1167-1168	2	16
α-helix	1171-1177	7
β-strand	1179-1181	3	17
β-strand	1190-1191	2	16
α-helix	1192	1
β-strand	1196-1198	3	18
β-strand	1199-1201	3	17
α-helix	1202	1
β-strand	1205-1207	3	19
β-strand	1215-1217	3	18
β-strand	1219	1	20
β-strand	1222	1	20
β-strand	1228-1230	3	19

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Complement factor H	A, B	protein	129	Homo sapiens	P08603 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>3R62_1 Complement factor H (chains A, B)
EAEFGKCGPPPPIDNGDITSFPLSVYAPASSVEYQCQNLYQLEGNKRITCRNGQWSEPPK
CLHPCVISREIMENYNIALRWRAKQKLYSRTGESVEFVCKRGYRLSSRSHTLRTTCWDGK
LEYPTCAKR

Primary citation

Crystallographic determination of the disease-associated T1184R variant of the complement Factor H. Morgan, H.P., Jiang, J., Herbert, A.P. et al. Acta Crystallogr D Biol Crystallogr (2011) 67:593-600.

Other PDB entries of the same protein (UniProt P08603 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4K12 1.08 Å, Structural Basis for Host Specificity of Factor H Binding by Streptococcus pneumoniae
3KZJ 1.65 Å, Structure of complement Factor H variant R1203A
2G7I 1.75 Å, Structure of Human Complement Factor H Carboxyl Terminal Domains 19-20: a Basis for…
3SW0 1.8 Å, Structure of the C-terminal region (modules 18-20) of complement regulator Factor H
6ATG 1.8 Å, Insights to complement factor H recruitment by the borrelial CspZ protein as revealed by…
9MLU 1.82 Å, FbaA with Factor H 6-7 domain
9MMX 1.9 Å, M6 protein with Factor H 6-7 domain
3KXV 2.0 Å, Structure of complement Factor H variant Q1139A
3OXU 2.1 Å, Complement components factor H CCP19-20 and C3d in complex
4ONT 2.15 Å, Ternary host recognition complex of complement factor H, C3d, and sialic acid
6ZH1 2.2 Å, Crystal structure of complex between FH19-20 and FhbA protein from Borrelia hermsii
4ZH1 2.24 Å, Complement factor H in complex with the GM1 glycan

Browse structure collections

About this viewer

MolViewer shows 3R62 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.