3R8J: Human SOUL protein

Crystal structure of human SOUL protein (orthorhombic form). Determined by X-ray diffraction at 1.6 Å resolution. Released 29 Jun 2011.

Method: X-ray diffraction
Resolution: 1.6 Å
Organism: Homo sapiens
Chains: 2
Atoms: 3,373
Mol. weight: 47.42 kDa
Ligands: PO4
Released: 29 Jun 2011

Explore 3R8J in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3R8J contains 16 α-helices and 28 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 8 helices, 15 β-strands

Element	Residues	Length	Sheet
β-strand	21	1	1
β-strand	25-26	2	2
β-strand	39-43	5	2
α-helix	44-45	2
β-strand	46-55	10	2
α-helix	58-73	16
β-strand	77	1	3
β-strand	86	1	1
β-strand	89-94	6	2
α-helix	102	1
β-strand	103-110	8	2
α-helix	111-112	2
α-helix	113-116	4
α-helix	119-121	3
β-strand	122	1	3
β-strand	127-132	6	2
α-helix	133-134	2
β-strand	135-142	8	2
α-helix	148-164	17
β-strand	169	1	4
β-strand	174-178	5	2
β-strand	190-195	6	2
β-strand	196	1	4

Chain B: 8 helices, 13 β-strands

Element	Residues	Length	Sheet
β-strand	25-26	2	2
α-helix	34-35	2
β-strand	39-43	5	2
α-helix	44-45	2
β-strand	46-55	10	2
α-helix	58-73	16
β-strand	77	1	5
β-strand	89-94	6	2
β-strand	104-110	7	2
α-helix	111-112	2
α-helix	113-116	4
α-helix	119-121	3
β-strand	122	1	5
β-strand	127-132	6	2
α-helix	133-134	2
β-strand	135-142	8	2
α-helix	148-164	17
β-strand	169	1	6
β-strand	174-178	5	2
β-strand	190-195	6	2
β-strand	196	1	6

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Heme-binding protein 2	A, B	protein	212	Homo sapiens	Q9Y5Z4 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>3R8J_1 Heme-binding protein 2 (chains A, B)
MRGSAEPLQPDPGAAEDAAAQAVETPGWKAPEDAGPQPGSYEIRHYGPAKWVSTSVESMD
WDSAIQTGFTKLNSYIQGKNEKEMKIKMTAPVTSYVEPGSGPFSESTITISLYIPSEQQF
DPPRPLESDVFIEDRAEMTVFVRSFDGFSSAQKNQEQLLTLASILREDGKVFDEKVYYTA
GYNSPVKLLNRNNEVWLIQKNEPTKENELVPR

Ligands and cofactors

ID	Name	Formula	Copies
PO4	Phosphate ion	O4 P	1

Primary citation

Structural changes in the BH3 domain of SOUL protein upon interaction with the anti-apoptotic protein Bcl-xL. Ambrosi, E., Capaldi, S., Bovi, M. et al. Biochem J (2011) 438:291-301. DOI 10.1042/BJ20110257 · PubMed

Other PDB entries of the same protein (UniProt Q9Y5Z4 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3R85 1.95 Å, Crystal structure of human SOUL BH3 domain in complex with Bcl-xL
5GQQ 2.2 Å, Structure of ALG-2/HEBP2 Complex
3R8K 2.85 Å, Crystal structure of human SOUL protein (hexagonal form)
4AYZ 3.5 Å, X-ray Structure of human SOUL
4B0Y 3.5 Å, Determination of X-ray Structure of human SOUL by Molecular Replacement

Browse structure collections

About this viewer

MolViewer shows 3R8J directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.