4B0Y: Heme-binding protein 2

Determination of X-ray Structure of human SOUL by Molecular Replacement. Determined by X-ray diffraction at 3.5 Å resolution. Released 1 Aug 2012.

Method: X-ray diffraction
Resolution: 3.5 Å
Organism: HOMO SAPIENS
Chains: 1
Atoms: 1,264
Mol. weight: 25.55 kDa
Released: 1 Aug 2012

Explore 4B0Y in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4B0Y contains 8 α-helices and 15 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 8 helices, 15 β-strands

Element	Residues	Length	Sheet
β-strand	21	1	1
β-strand	25-26	2	2
β-strand	39-43	5	2
β-strand	46-55	10	2
α-helix	58-74	17
β-strand	77	1	3
β-strand	86	1	1
α-helix	88	1
β-strand	89-94	6	2
α-helix	101-102	2
β-strand	103-110	8	2
α-helix	111-112	2
α-helix	113-115	3
α-helix	119-121	3
β-strand	122	1	3
β-strand	127-132	6	2
α-helix	133-134	2
β-strand	135-142	8	2
α-helix	148-165	18
β-strand	169	1	4
β-strand	174-178	5	2
β-strand	190-195	6	2
β-strand	196	1	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Heme-binding protein 2	A	protein	227	HOMO SAPIENS	Q9Y5Z4 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>4B0Y_1 HEME-BINDING PROTEIN 2 (chains A)
MSYYHHHHHHLESTSLYKKAGTMAEPLQPDPGAAEDAAAQAVETPGWKAPEDAGPQPGSY
EIRHYGPAKWVSTSVESMDWDSAIQTGFTKLNSYIQGKNEKEMKIKMTAPVTSYVEPGSG
PFSESTITISLYIPSEQQFDPPRPLESDVFIEDRAEMTVFVRSFDGFSSAQKNQEQLLTL
ASILREDGKVFDEKVYYTAGYNSPVKLLNRNNEVWLIQKNEPTKENE

Primary citation

Human Soul: A Heme-Binding or a Bh3 Domain-Containing Protein. Freire, F., Carvalho, A.L., Aveiro, S.S. et al. To be published.

Other PDB entries of the same protein (UniProt Q9Y5Z4 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3R8J 1.6 Å, Crystal structure of human SOUL protein (orthorhombic form)
3R85 1.95 Å, Crystal structure of human SOUL BH3 domain in complex with Bcl-xL
5GQQ 2.2 Å, Structure of ALG-2/HEBP2 Complex
3R8K 2.85 Å, Crystal structure of human SOUL protein (hexagonal form)
4AYZ 3.5 Å, X-ray Structure of human SOUL

Browse structure collections

About this viewer

MolViewer shows 4B0Y directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.