4AYZ: Human SOUL

X-ray Structure of human SOUL. Determined by X-ray diffraction at 3.5 Å resolution. Released 11 Jul 2012.

Method: X-ray diffraction
Resolution: 3.5 Å
Organism: HOMO SAPIENS
Chains: 2
Atoms: 2,729
Mol. weight: 46.79 kDa
Released: 11 Jul 2012

Explore 4AYZ in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4AYZ contains 19 α-helices and 24 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 11 helices, 11 β-strands

Element	Residues	Length	Sheet
β-strand	25-26	2	1
α-helix	34-35	2
β-strand	39-43	5	1
α-helix	44-45	2
β-strand	46-55	10	1
α-helix	58-74	17
β-strand	77	1	2
α-helix	88	1
β-strand	89-94	6	1
α-helix	102	1
β-strand	103-110	8	1
α-helix	111-112	2
α-helix	114-116	3
α-helix	119-121	3
β-strand	122	1	2
β-strand	127-132	6	1
α-helix	133-134	2
β-strand	135-142	8	1
α-helix	148-164	17
β-strand	174-178	5	1
α-helix	188-189	2
β-strand	190-195	6	1

Chain B: 8 helices, 13 β-strands

Element	Residues	Length	Sheet
β-strand	25-26	2	3
β-strand	39-43	5	3
α-helix	44-45	2
β-strand	46-54	9	3
α-helix	58-74	17
β-strand	77	1	4
α-helix	82-85	4
α-helix	88	1
β-strand	89-94	6	3
β-strand	104-110	7	3
α-helix	111-112	2
α-helix	119-121	3
β-strand	122	1	4
β-strand	127-132	6	3
α-helix	133-134	2
β-strand	135-142	8	3
α-helix	148-165	18
β-strand	169	1	5
β-strand	174-178	5	3
β-strand	190-195	6	3
β-strand	196	1	5

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Heme-binding protein 2	A	protein	208	HOMO SAPIENS	Q9Y5Z4 (AlphaFold model)
Heme-binding protein 2	B	protein	208	HOMO SAPIENS	Q9Y5Z4 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>4AYZ_1 HEME-BINDING PROTEIN 2 (chains A)
AGHMAEPLQPDPGAAEDAAAQAVETPGWKAPEDAGPQPGSYEIRHYGPAKWVSTSVESMD
WDSAIQTGFTKLNSYIQGKNEKEMKIKMTAPVTSYVEPGSGPFSESTITISLYIPSEQQF
DPPRPLESDVFIEDRAEMTVFVRSFDGFSSAQKNQEQLLTLASILREDGKVFDEKVYYTA
GYNSPVKLLNRNNEVWLIQKNEPTKENE

Sequence of entity 2 (B), FASTA

>4AYZ_2 HEME-BINDING PROTEIN 2 (chains B)
AGHMAEPLQPDPGAAEDAAAQAVETPGWKAPEDAGPQPGSYEIRHYGPAKWVSTSVESMD
WDSAIQTGFTKLNSYIQGKNEKEMKIKMTAPVTSYVEPGSGPFESSTITISLYIPSEQQF
DPPRPLESDVFIEDRAEMTVFVRSFDGFSSAQKNQEQLLTLASILREDGKVFDEKVYYTA
GYNSPVKLLNRNNEVWLIQKNEPTKENE

Primary citation

Human Soul: A Heme-Binding or a Bh3 Domain-Containing Protein. Freire, F., Carvalho, A.L., Aveiro, S.S. et al. To be published.

Other PDB entries of the same protein (UniProt Q9Y5Z4 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3R8J 1.6 Å, Crystal structure of human SOUL protein (orthorhombic form)
3R85 1.95 Å, Crystal structure of human SOUL BH3 domain in complex with Bcl-xL
5GQQ 2.2 Å, Structure of ALG-2/HEBP2 Complex
3R8K 2.85 Å, Crystal structure of human SOUL protein (hexagonal form)
4B0Y 3.5 Å, Determination of X-ray Structure of human SOUL by Molecular Replacement

Browse structure collections

About this viewer

MolViewer shows 4AYZ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.