3R8K: Human SOUL protein

Crystal structure of human SOUL protein (hexagonal form). Determined by X-ray diffraction at 2.85 Å resolution. Released 29 Jun 2011.

Method: X-ray diffraction
Resolution: 2.85 Å
Organism: Homo sapiens
Chains: 4
Atoms: 5,631
Mol. weight: 94.65 kDa
Released: 29 Jun 2011

Explore 3R8K in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3R8K contains 29 α-helices and 58 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 9 helices, 13 β-strands

Element	Residues	Length	Sheet
β-strand	25-26	2	1
α-helix	29-31	3
α-helix	34	1
β-strand	39-43	5	2
α-helix	44-45	2
β-strand	46-55	10	2
α-helix	58-73	16
β-strand	77	1	3
α-helix	88	1
β-strand	89-94	6	2
β-strand	103-110	8	2
α-helix	119-121	3
β-strand	122	1	3
β-strand	127-132	6	2
α-helix	133-134	2
β-strand	135-141	7	2
α-helix	148-164	17
β-strand	169	1	4
β-strand	174-178	5	2
β-strand	191-195	5	2
β-strand	196	1	4
α-helix	197	1

Chain B: 6 helices, 13 β-strands

Element	Residues	Length	Sheet
β-strand	25-26	2	2
α-helix	29-31	3
α-helix	33-34	2
β-strand	39-43	5	1
α-helix	44-45	2
β-strand	46-53	8	1
α-helix	58-74	17
β-strand	77	1	5
β-strand	89-94	6	1
β-strand	104-110	7	1
β-strand	122	1	5
β-strand	127-132	6	1
α-helix	133-134	2
β-strand	135-141	7	1
α-helix	148-164	17
β-strand	169	1	6
β-strand	174-178	5	1
β-strand	191-195	5	1
β-strand	196	1	6

Chain C: 7 helices, 17 β-strands

Element	Residues	Length	Sheet
β-strand	21	1	7
β-strand	25-26	2	8
β-strand	39-43	5	8
β-strand	46-55	10	8
α-helix	58-74	17
β-strand	77	1	9
β-strand	86	1	7
α-helix	88	1
β-strand	89	1	10
β-strand	90-94	5	8
β-strand	103-110	8	8
α-helix	113-116	4
α-helix	119-121	3
β-strand	122	1	9
β-strand	127-132	6	8
α-helix	133-134	2
β-strand	135-141	7	8
α-helix	148-163	16
β-strand	169	1	11
β-strand	174-177	4	8
β-strand	178	1	10
β-strand	191-195	5	8
β-strand	196	1	11
α-helix	197	1

Chain D: 7 helices, 15 β-strands

Element	Residues	Length	Sheet
β-strand	21	1	12
β-strand	25-26	2	13
β-strand	39-43	5	13
α-helix	44-45	2
β-strand	46-55	10	13
α-helix	58-74	17
β-strand	77	1	14
β-strand	86	1	12
β-strand	89-94	6	13
β-strand	103-110	8	13
α-helix	113-115	3
α-helix	119-121	3
β-strand	122	1	14
β-strand	127-132	6	13
α-helix	133-134	2
β-strand	135-141	7	13
α-helix	148-164	17
β-strand	169	1	15
β-strand	174-178	5	13
β-strand	191-195	5	13
β-strand	196	1	15
α-helix	197	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Heme-binding protein 2	A, B, C, D	protein	212	Homo sapiens	Q9Y5Z4 (AlphaFold model)

Sequence of entity 1 (A, B, C, D), FASTA

>3R8K_1 Heme-binding protein 2 (chains A, B, C, D)
MRGSAEPLQPDPGAAEDAAAQAVETPGWKAPEDAGPQPGSYEIRHYGPAKWVSTSVESMD
WDSAIQTGFTKLNSYIQGKNEKEMKIKMTAPVTSYVEPGSGPFSESTITISLYIPSEQQF
DPPRPLESDVFIEDRAEMTVFVRSFDGFSSAQKNQEQLLTLASILREDGKVFDEKVYYTA
GYNSPVKLLNRNNEVWLIQKNEPTKENELVPR

Primary citation

Structural changes in the BH3 domain of SOUL protein upon interaction with the anti-apoptotic protein Bcl-xL. Ambrosi, E., Capaldi, S., Bovi, M. et al. Biochem J (2011) 438:291-301. DOI 10.1042/BJ20110257 · PubMed

Other PDB entries of the same protein (UniProt Q9Y5Z4 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3R8J 1.6 Å, Crystal structure of human SOUL protein (orthorhombic form)
3R85 1.95 Å, Crystal structure of human SOUL BH3 domain in complex with Bcl-xL
5GQQ 2.2 Å, Structure of ALG-2/HEBP2 Complex
4AYZ 3.5 Å, X-ray Structure of human SOUL
4B0Y 3.5 Å, Determination of X-ray Structure of human SOUL by Molecular Replacement

Browse structure collections

About this viewer

MolViewer shows 3R8K directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.