3RI4: Isoform Ets-1 p27 of Protein C-ets-1

Ets1 cooperative binding to widely separated sites on promoter DNA. Determined by X-ray diffraction at 3.0 Å resolution. Released 4 Apr 2012.

Method: X-ray diffraction
Resolution: 3.0 Å
Organism: Homo sapiens
Chains: 6
Atoms: 3,567
Mol. weight: 57.47 kDa
Released: 4 Apr 2012

Explore 3RI4 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3RI4 contains 16 α-helices and 8 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 8 helices, 4 β-strands

Element	Residues	Length	Sheet
α-helix	304-312	9
α-helix	323-330	8
α-helix	337-346	10
α-helix	348-350	3
β-strand	355-356	2	1
β-strand	362-364	3	1
α-helix	368-378	11
α-helix	386-398	13
β-strand	402-404	3	1
β-strand	411-414	4	1
α-helix	418-422	5
α-helix	426-432	7

Chain D: 8 helices, 4 β-strands

Element	Residues	Length	Sheet
α-helix	304-312	9
α-helix	323-330	8
α-helix	337-344	8
α-helix	348-350	3
β-strand	355-356	2	2
β-strand	362-364	3	2
α-helix	368-378	11
α-helix	386-398	13
β-strand	402-404	3	2
β-strand	411-414	4	2
α-helix	418-422	5
α-helix	426-432	7

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Isoform Ets-1 p27 of Protein C-ets-1	A, D	protein	163	Homo sapiens	P14921 (AlphaFold model)
TCR alpha promoter DNA	B, E	DNA	16
TCR alpha promoter DNA	C, F	DNA	16

Sequence of entity 1 (A, D), FASTA

>3RI4_1 Isoform Ets-1 p27 of Protein C-ets-1 (chains A, D)
MVPSYDSFDYEDYPAALPNHKPKGTFKDYVRDRADLNKDKPVIPAAALAGYTGSGPIQLW
QFLLELLTDKSCQSFISWTGDGWEFKLSDPDEVARRWGKRKNKPKMNYEKLSRGLRYYYD
KNIIHKTAGKRYVYRFVCDLQSLLGYTPEELHAMLDVKPDADE

Sequence of entity 2 (B, E), FASTA

>3RI4_2 TCR alpha promoter DNA (chains B, E)
GGAAGCCACATCCTCT

Sequence of entity 3 (C, F), FASTA

>3RI4_3 TCR alpha promoter DNA (chains C, F)
CAGAGGATGTGGCTTC

Primary citation

Structural basis of ets1 cooperative binding to widely separated sites on promoter DNA. Babayeva, N.D., Baranovskaya, O.I., Tahirov, T.H. PLoS One (2012) 7:e33698-e33698. DOI 10.1371/journal.pone.0033698 · PubMed

Other PDB entries of the same protein (UniProt P14921 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1GVJ 1.53 Å, Ets-1 DNA binding and autoinhibitory domains
4LG0 2.19 Å, Structure of a ternary FOXO1-ETS1 DNA complex
4L18 2.3 Å, Crystal structure of Runx1 and Ets1 bound to TCR alpha promoter (crystal form 3)
3WTS 2.35 Å, Crystal structure of the complex comprised of ETS1, RUNX1, CBFBETA, and the tcralpha…
3WTT 2.35 Å, Crystal structure of the complex comprised of phosphorylated ETS1, RUNX1, CBFBETA, and…
3WU1 2.4 Å, Crystal structure of the ETS1-RUNX1-DNA ternary complex
4L0Y 2.5 Å, Crystal structure of Runx1 and Ets1 bound to TCR alpha promoter (crystal form 1)
2NNY 2.58 Å, Crystal structure of the Ets1 dimer DNA complex.
3WU0 2.6 Å, Crystal structure of phosphorylated ETS-1 DNA binding and autoinhibitory domains (276-441)
3WTZ 2.61 Å, Crystal structure of ETS-1 DNA binding and autoinhibitory domains (276-441)
3WTU 2.7 Å, Crystal structure of the complex comprised of ETS1 (V170A), RUNX1, CBFBETA, and the…
3WTV 2.7 Å, Crystal structure of the complex comprised of ETS1(V170G), RUNX1, CBFBETA, and the…

Browse structure collections

About this viewer

MolViewer shows 3RI4 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.