3TMH: Dual-specific A-kinase anchoring protein 2
Crystal structure of dual-specific A-kinase anchoring protein 2 in complex with cAMP-dependent protein kinase A type II alpha and PDZK1. Determined by X-ray diffraction at 3.8 Å resolution. Released 5 Sept 2012.
- Method
- X-ray diffraction
- Resolution
- 3.8 Å
- Organisms
- Homo sapiens, Rattus norvegicus
- Chains
- 10
- Atoms
- 3,553
- Mol. weight
- 65.26 kDa
- Released
- 5 Sept 2012
Explore 3TMH in 3D
Show helices and sheets
RCSB PDB
PDBe
Secondary structure: helices and β-sheets
3TMH contains 22 α-helices and 29 β-strands across 10 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
Chains A and E: 4 helices, 8 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 376-382 | 7 | 1 |
| β-strand | 384 | 1 | 2 |
| β-strand | 387 | 1 | 2 |
| β-strand | 391-395 | 5 | 1 |
| β-strand | 401-402 | 2 | 1 |
| α-helix | 406-407 | 2 | |
| α-helix | 411-414 | 4 | |
| α-helix | 421 | 1 | |
| β-strand | 422-426 | 5 | 1 |
| β-strand | 429-430 | 2 | 1 |
| α-helix | 436-445 | 10 | |
| β-strand | 449-455 | 7 | 1 |
Chains B and F: 2 helices, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 9-21 | 13 | |
| α-helix | 29-42 | 14 | |
Chain C: 2 helices, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 9-21 | 13 | |
| α-helix | 29-40 | 12 | |
Chains D and L: 1 helix, 1 β-strand
| Element | Residues | Length | Sheet |
|---|
| α-helix | 637-651 | 15 | |
| β-strand | 657-661 | 5 | 1 |
Chain G: 2 helices, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 9-21 | 13 | |
| α-helix | 29-38 | 10 | |
Chain H: 1 helix, 1 β-strand
| Element | Residues | Length | Sheet |
|---|
| α-helix | 641-651 | 11 | |
| β-strand | 657-661 | 5 | 3 |
Chain I: 3 helices, 10 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 376-382 | 7 | 5 |
| β-strand | 384 | 1 | 6 |
| β-strand | 387 | 1 | 6 |
| β-strand | 391-395 | 5 | 5 |
| β-strand | 396 | 1 | 7 |
| β-strand | 398 | 1 | 7 |
| β-strand | 401-402 | 2 | 5 |
| α-helix | 411-414 | 4 | |
| α-helix | 421 | 1 | |
| β-strand | 422-426 | 5 | 5 |
| β-strand | 429-430 | 2 | 5 |
| α-helix | 436-445 | 10 | |
| β-strand | 449-455 | 7 | 5 |
Molecules and chains
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|
| Na(+)/H(+) exchange regulatory cofactor NHE-RF3 | A, E, I | protein | 87 | Homo sapiens | Q5T2W1 (AlphaFold model) |
| cAMP-dependent protein kinase type II-alpha regulatory subunit | B, C, F, G | protein | 48 | Rattus norvegicus | P12368 (AlphaFold model) |
| A-kinase anchor protein 10, mitochondrial | D, H, L | protein | 45 | Homo sapiens | O43572 (AlphaFold model) |
Sequence of entity 1 (A, E, I), FASTA
>3TMH_1 Na(+)/H(+) exchange regulatory cofactor NHE-RF3 (chains A, E, I)
GSKPKLCRLAKGENGYGFHLNAIRGLPGSFIKEVQKGGPADLAGLEDEDVIIEVNGVNVL
DEPYEKVVDRIQSSGKNVTLLVCGKKA
Sequence of entity 2 (B, C, F, G), FASTA
>3TMH_2 cAMP-dependent protein kinase type II-alpha regulatory subunit (chains B, C, F, G)
GSHMGHIQIPPGLTELLQGYTVEVLRQQPPDLVDFAVEYFTRLREARR
Sequence of entity 3 (D, H, L), FASTA
>3TMH_3 A-kinase anchor protein 10, mitochondrial (chains D, H, L)
GSPEFVQGNTDEAQEELAWKIAKMIVSDVMQQAQYDQPLEKSTKL
Primary citation
Differential mode of D-AKAP2 to PKA isoforms: Insights from D-AKAP2 PKA RII PDZK1 ternary complex structure. Sarma, G.N., Phan, R.H., Sankaran, B. et al. To be published.
Other PDB entries of the same protein (UniProt Q5T2W1 (AlphaFold model), which also has an AlphaFold model), best resolution first:
- 9RXO 1.2 Å, Structure of the PDZ2 domain from human PDZK1 (NHERF3) with the C-terminal residues…
- 9RXN 1.36 Å, Structure of the PDZ1 domain from human PDZK1 (NHERF3) with the C-terminal residues…
- 9RXP 1.43 Å, Structure of the PDZ4 domain from human PDZK1 (NHERF3) with the C-terminal residues…
- 6EZI 1.5 Å, PDZK1 domain 4 in complex with C-terminal peptide of human PepT2.
- 9RXR 1.69 Å, Structure of the PDZ1 domain from human PDZK1 (NHERF3) with the C-terminal residues…
- 9RXS 2.0 Å, Structure of the PDZ4 domain from human PDZK1 (NHERF3) with the C-terminal residues…
- 4Q2P 2.05 Å, NHERF3 PDZ2 in Complex with a Phage-Derived Peptide
- 2VSP 2.41 Å, Crystal structure of the fourth PDZ domain of PDZ domain-containing protein 1
- 2EEI Solution Structure of Second PDZ domain of PDZ Domain Containing Protein 1
- 2EEJ Solution Structure of Fourth PDZ domain of PDZ Domain Containing Protein 1
Browse structure collections
About this viewer
MolViewer shows 3TMH directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.