3UNP: Human SUN2 SUN domain

Structure of human SUN2 SUN domain. Determined by X-ray diffraction at 2.39 Å resolution. Released 21 Dec 2011.

Method: X-ray diffraction
Resolution: 2.39 Å
Organism: Homo sapiens
Chains: 1
Atoms: 1,541
Mol. weight: 22.93 kDa
Ligands: ACE
Released: 21 Dec 2011

Explore 3UNP in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3UNP contains 4 α-helices and 11 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 4 helices, 11 β-strands

Element	Residues	Length	Sheet
α-helix	524-539	16
β-strand	556	1	1
α-helix	587-591	5
β-strand	601-604	4	2
β-strand	608-626	19	1
α-helix	630-632	3
α-helix	634-636	3
β-strand	642	1	3
β-strand	644-649	6	1
β-strand	659-665	7	1
β-strand	673-677	5	1
β-strand	686-693	8	1
β-strand	696	1	3
β-strand	702-705	4	2
β-strand	707-714	8	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
SUN domain-containing protein 2	A	protein	203	Homo sapiens	Q9UH99 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>3UNP_1 SUN domain-containing protein 2 (chains A)
VIGVTEEQVHHIVKQALQRYSEDRIGLADYALESGGASVISTRCSETYETKTALLSLFGI
PLWYHSQSPRVILQPDVHPGNCWAFQGPQGFAVVRLSARIRPTAVTLEHVPKALSPNSTI
SSAPKDFAIFGFDEDLQQEGTLLGKFTYDQDGEPIQTFHFQAPTMATYQVVELRILTNWG
HPEYTCIYRFRVHGEPAHHHHHH

Ligands and cofactors

ID	Name	Formula	Copies
ACE	Acetyl group	C2 H4 O	1

Primary citation

Structure of Sad1-UNC84 homology (SUN) domain defines features of molecular bridge in nuclear envelope. Zhou, Z.C., Du, X., Cai, Z. et al. J Biol Chem (2012) 287:5317-5326. DOI 10.1074/jbc.M111.304543 · PubMed

Other PDB entries of the same protein (UniProt Q9UH99 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6WMD 1.5 Å, Human Sun2-KASH4 complex
6WME 1.53 Å, Human Sun2-KASH3 complex
6WMG 1.9 Å, Human Sun2 (500-717)
4DXT 2.22 Å, Human SUN2 (AA 522-717)
4DXR 2.32 Å, Human SUN2-KASH1 complex
6WMF 2.6 Å, Human Sun2-KASH5 complex
4DXS 2.71 Å, Human SUN2-KASH2 complex
4FI9 3.05 Å, Structure of human SUN-KASH complex

Browse structure collections

About this viewer

MolViewer shows 3UNP directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.