3VEJ: Get5 carboxyl domain from S. cerevisiae

Crystal structure of the Get5 carboxyl domain from S. cerevisiae. Determined by X-ray diffraction at 1.23 Å resolution. Released 25 Jan 2012.

Method: X-ray diffraction
Resolution: 1.23 Å
Organism: Saccharomyces cerevisiae
Chains: 2
Atoms: 805
Mol. weight: 9.56 kDa
Ligands: PO4
Released: 25 Jan 2012

Explore 3VEJ in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3VEJ contains 4 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A and B: 2 helices, 0 β-strands

Element	Residues	Length	Sheet
α-helix	179-189	11
α-helix	194-210	17

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Ubiquitin-like protein MDY2	A, B	protein	41	Saccharomyces cerevisiae	Q12285 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>3VEJ_1 Ubiquitin-like protein MDY2 (chains A, B)
SVDLTVPWDDIEALLKNNFENDQAAVRQVMERLQKGWSLAK

Ligands and cofactors

ID	Name	Formula	Copies
PO4	Phosphate ion	O4 P	1

Primary citation

Get5 Carboxyl-terminal Domain Is a Novel Dimerization Motif That Tethers an Extended Get4/Get5 Complex. Chartron, J.W., Vandervelde, D.G., Rao, M. et al. J Biol Chem (2012) 287:8310-8317. DOI 10.1074/jbc.M111.333252 · PubMed

Other PDB entries of the same protein (UniProt Q12285 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4A20 1.78 Å, Crystal structure of the Ubl domain of Mdy2 (Get5) at 1.78A
3ZDM 1.8 Å, Crystal structure of the Sgt2 N domain and the Get5 UBL domain complex
2WPV 1.99 Å, Crystal structure of S. cerevisiae Get4-Get5 complex
4GOC 2.4 Å, Crystal structure of the Get5 ubiquitin-like domain
3LKU 2.8 Å, Crystal structure of S. cerevisiae Get4 in complex with an N-terminal fragment of Get5
5BW8 2.8 Å, 2.8 A crystal structure of a Get3-Get4-Get5 intermediate complex from S.cerevisiae
9NS5 3.19 Å, Get3(D57N)-Get4/5 Complex (ATP-bound)
4PWX 5.4 Å, Crystal structure of an ATP-bound Get3-Get4-Get5 complex from S.cerevisiae
5BWK 6.0 Å, 6.0 A Crystal structure of a Get3-Get4-Get5 intermediate complex from S.cerevisiae
2LNZ Solution structure of the Get5 carboxyl domain from S. cerevisiae
2LXA Solution structure of the Get5 ubiquitin-like domain
2LXC Solution structure of the complex between the Sgt2 homodimerization domain and the Get5…

Browse structure collections

About this viewer

MolViewer shows 3VEJ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.