3VF0: Raver1

Raver1 in complex with metavinculin L954 deletion mutant. Determined by X-ray diffraction at 2.54 Å resolution. Released 25 Jul 2012.

Method: X-ray diffraction
Resolution: 2.54 Å
Organism: Homo sapiens
Chains: 2
Atoms: 3,945
Mol. weight: 64.21 kDa
Released: 25 Jul 2012

Explore 3VF0 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3VF0 contains 22 α-helices and 22 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 7 helices, 4 β-strands

Element	Residues	Length	Sheet
α-helix	963-977	15
β-strand	979	1	1
α-helix	985-1003	19
α-helix	1010-1036	27
β-strand	1039	1	2
α-helix	1042-1053	12
α-helix	1055-1073	19
α-helix	1080-1111	32
β-strand	1115	1	2
α-helix	1116	1
β-strand	1127	1	1

Chain B: 15 helices, 18 β-strands

Element	Residues	Length	Sheet
α-helix	38-40	3
α-helix	41-55	15
β-strand	60-64	5	3
α-helix	72-78	7
β-strand	84-90	7	3
β-strand	95-100	6	3
α-helix	103-113	11
β-strand	117-118	2	4
β-strand	121-122	2	4
α-helix	123	1
β-strand	124-127	4	3
β-strand	133-137	5	5
α-helix	145-152	8
α-helix	153-155	3
β-strand	158-165	8	5
β-strand	172-180	9	5
α-helix	183-193	11
β-strand	197-198	2	6
β-strand	201-202	2	6
β-strand	204-207	4	5
α-helix	210-212	3
α-helix	216-218	3
β-strand	222-226	5	7
α-helix	228-229	2
α-helix	235-241	7
β-strand	250-255	6	7
β-strand	261-268	8	7
α-helix	272-282	11
β-strand	286-287	2	8
β-strand	290-291	2	8
β-strand	293-296	4	7
α-helix	297-298	2
α-helix	303-318	16

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Vinculin	A	protein	283	Homo sapiens	P18206 (AlphaFold model)
Ribonucleoprotein PTB-binding 1	B	protein	285	Homo sapiens	Q8IY67 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>3VF0_1 Vinculin (chains A)
GSHMDELAPPKPPLPEGEVPPPRPPPPEEKDEEFPEQKAGEVINQPMMMAARQLHDEARK
WSSKPGIPAAEVGIGVVAEADAADAAGFPVPPDMEDDYEPELLLMPSNQPVNQPILAAAQ
SLHREATKWSSKGNDIIAAAKRMALLMAEMSRLVRGGSGTKRALIQCAKDIAKASDEVTR
LAKEVAKQCTDKRIRTNLLQVCERIPTISTQLKILSTVKATMLGRTNISDEESEQATEML
VHNAQNLMQSVKETVREAEAASIKIRTDAGFTLRWVRKTPWYQ

Sequence of entity 2 (B), FASTA

>3VF0_2 Ribonucleoprotein PTB-binding 1 (chains B)
HMLDPEEIRKRLEHTERQFRNRRKILIRGLPGDVTNQEVHDLLSDYELKYCFVDKYKGTA
FVTLLNGEQAEAAINAFHQSRLRERELSVQLQPTDALLCVANLPPSLTQQQFEELVRPFG
SLERCFLVYSERTGQSKGYGFAEYMKKDSAARAKSDLLGKPLGPRTLYVHWTDAGQLTPA
LLHSRCLCVDRLPPGFNDVDALCRALSAVHSPTFCQLACGQDGQLKGFAVLEYETAEMAE
EAQQQADGLSLGGSHLRVSFCAPGPPGRSMLAALIAAQATALNRG

Primary citation

The Metavinculin Tail Domain Directs Constitutive Interactions with Raver1 and vinculin RNA. Lee, J.H., Rangarajan, E.S., Vonrhein, C. et al. J Mol Biol (2012) 422:697-704. DOI 10.1016/j.jmb.2012.06.015 · PubMed

Other PDB entries of the same protein (UniProt P18206 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4LN2 1.0 Å, The second SH3 domain from CAP/Ponsin in complex with proline rich peptide from Vinculin
4LNP 1.41 Å, The first SH3 domain from CAP/Ponsin in complex with proline rich peptide from Vinculin
3RF3 1.61 Å, Shigella IpaA-VBS3 in complex with human vinculin
1YDI 1.8 Å, Human Vinculin Head Domain (VH1, 1-258) in Complex with Human Alpha-Actinin's…
3S90 1.97 Å, Human vinculin head domain Vh1 (residues 1-252) in complex with murine talin (VBS33;…
3TJ5 1.99 Å, human vinculin head domain (Vh1, residues 1-258) in complex with the vinculin binding…
3MYI 2.2 Å, Human metavinculin tail domain
4DJ9 2.25 Å, Human vinculin head domain Vh1 (residues 1-258) in complex with the talin vinculin…
1RKE 2.35 Å, Human vinculin head (1-258) in complex with human vinculin tail (879-1066)
1SYQ 2.42 Å, Human vinculin head domain VH1, residues 1-258, in complex with human talin's vinculin…
5L0I 2.45 Å, Human metavinculin MVt R975W cardiomyopathy-associated mutant (residues 959-1134)
9QWO 2.54 Å, Vinculin tail bound to paxillin LD2

Browse structure collections

About this viewer

MolViewer shows 3VF0 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.