3ZEV: Neurotensin receptor 1 TM86V

Structure of Thermostable Agonist-bound Neurotensin Receptor 1 Mutant without Lysozyme Fusion. Determined by X-ray diffraction at 3.0 Å resolution. Released 29 Jan 2014.

Method: X-ray diffraction
Resolution: 3.0 Å
Organism: RATTUS NORVEGICUS
Chains: 4
Atoms: 4,956
Mol. weight: 77.46 kDa
Ligands: GLY
Released: 29 Jan 2014

Explore 3ZEV in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3ZEV contains 35 α-helices and 4 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 18 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	53-55	3
α-helix	61-90	30
α-helix	98-115	18
α-helix	116-120	5
α-helix	121-124	4
α-helix	125-130	6
α-helix	139-172	34
α-helix	177-180	4
α-helix	183-200	18
α-helix	204-207	4
β-strand	208-212	5	1
α-helix	220-222	3
β-strand	223-227	5	1
α-helix	231-242	12
α-helix	243-247	5
α-helix	248-267	20
α-helix	298-333	36
α-helix	341-361	21
α-helix	364-372	9
α-helix	374-383	10

Chain B: 17 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	61-89	29
α-helix	98-115	18
α-helix	116-120	5
α-helix	121-124	4
α-helix	125-130	6
α-helix	138-172	35
α-helix	180-182	3
α-helix	183-200	18
α-helix	203-207	5
β-strand	208-212	5	2
α-helix	220-222	3
β-strand	223-227	5	2
α-helix	231-242	12
α-helix	243-247	5
α-helix	248-267	20
α-helix	299-333	35
α-helix	341-361	21
α-helix	364-372	9
α-helix	374-385	12

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Neurotensin receptor 1 TM86V	A, B	protein	338	RATTUS NORVEGICUS	P20789 (AlphaFold model)
Neurotensin	C, D	protein	8	RATTUS NORVEGICUS	P20068 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>3ZEV_1 NEUROTENSIN RECEPTOR 1 TM86V (chains A, B)
GPGSGPNSDLDVNTDIYSKVLVTAIYLALFVVGTVGNSVTLFTLARKKSLQSLQSTVDYY
LGSLALSDLLILLLAMPVELYNFIWVHHPWAFGDAGCRGYYFLRDACTYATALNVVSLSV
ELYLAICHPFKAKTLMSRSRTKKFISAIWLASALLAIPMLFTMGLQNLSGDGTHPGGLVC
TPIVDTATLKVVIQVNTFMSFLFPMLVASILNTVIANKLTVMVHQAAEQGRVCTEPGRVQ
ALRRGVLVLRAVVIAFVVCWLPYHVRRLMFCYISDEQWTTFLFDFYHYFYMLTNALVYVS
AAINPILYNLVSANFRQVFLSTLACLCPGTRELEVLFQ

Sequence of entity 2 (C, D), FASTA

>3ZEV_2 NEUROTENSIN (chains C, D)
GGRRPYIL

Ligands and cofactors

ID	Name	Formula	Copies
GLY	Glycine	C2 H5 N O2	5

Primary citation

Structure of Signaling-Competent Neurotensin Receptor 1 Obtained by Directed Evolution in Escherichia Coli. Egloff, P., Hillenbrand, M., Klenk, C. et al. Proc Natl Acad Sci U S A (2014) 111:E655. DOI 10.1073/PNAS.1317903111 · PubMed

Other PDB entries of the same protein (UniProt P20789 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6YVR 2.46 Å, Crystal structure of the neurotensin receptor 1 in complex with the peptide full agonist…
8FMZ 2.59 Å, Neurotensin receptor allosterism revealed in complex with a biased allosteric modulator
6Z4V 2.6 Å, Crystal structure of the neurotensin receptor 1 (NTSR1-H4bmx) in complex with NTS8-13
4XES 2.6 Å, Structure of active-like neurotensin receptor
6ZIN 2.64 Å, Crystal structure of the neurotensin receptor 1 in complex with the small molecule…
6Z4S 2.71 Å, Crystal structure of the neurotensin receptor 1 (NTSR1-H4bmx) in complex with the small…
6ZA8 2.72 Å, Crystal structure of the neurotensin receptor 1 in complex with the small-molecule…
4BUO 2.75 Å, High Resolution Structure of Thermostable Agonist-bound Neurotensin Receptor 1 Mutant…
4GRV 2.8 Å, The crystal structure of the neurotensin receptor NTS1 in complex with neurotensin (8-13)
6Z8N 2.8 Å, Crystal structure of the neurotensin receptor 1 in complex with the small-molecule full…
8FN1 2.88 Å, CryoEM structure of Go-coupled NTSR1
8FN0 2.89 Å, CryoEM structure of Go-coupled NTSR1 with a biased allosteric modulator

Browse structure collections

About this viewer

MolViewer shows 3ZEV directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.