3ZY0: Tumor protein P63

Crystal structure of a truncated variant of the human p63 tetramerization domain lacking the C-terminal helix. Determined by X-ray diffraction at 1.9 Å resolution. Released 30 Nov 2011.

Method: X-ray diffraction
Resolution: 1.9 Å
Organism: HOMO SAPIENS
Chains: 4
Atoms: 1,004
Mol. weight: 15.72 kDa
Released: 30 Nov 2011

Explore 3ZY0 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3ZY0 contains 4 α-helices and 4 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 1 helix, 1 β-strand

Element	Residues	Length	Sheet
β-strand	362-366	5	1
α-helix	369-387	19

Chain B: 1 helix, 1 β-strand

Element	Residues	Length	Sheet
β-strand	362-366	5	2
α-helix	369-384	16

Chains C and D: 1 helix, 1 β-strand

Element	Residues	Length	Sheet
β-strand	362-366	5	1
α-helix	369-385	17

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Tumor protein P63	A, B, C, D	protein	32	HOMO SAPIENS	Q9H3D4 (AlphaFold model)

Sequence of entity 1 (A, B, C, D), FASTA

>3ZY0_1 TUMOR PROTEIN P63 (chains A, B, C, D)
GSDELLYLPVRGRETYEMLLKIKESLELMQYL

Primary citation

Structure and Kinetic Stability of the P63 Tetramerization Domain. Natan, E., Joerger, A.C. J Mol Biol (2012) 415:503. DOI 10.1016/J.JMB.2011.11.007 · PubMed

Other PDB entries of the same protein (UniProt Q9H3D4 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2Y9U 1.6 Å, Structural basis of p63a SAM domain mutants involved in AEC syndrome
8P9C 1.76 Å, Crystal structure of p63-p73 heterotetramer (tetramerisation domain) in complex with…
7Z72 1.8 Å, Crystal structure of p63 SAM in complex with darpin A5
7Z7E 1.8 Å, Crystal structure of p63 DNA binding domain in complex with inhibitory DARPin G4
7Z71 1.85 Å, Crystal structure of p63 DBD in complex with darpin C14
6RU8 1.92 Å, Crystal structure of Casein Kinase I delta (CK1d) in complex with triple phosphorylated…
6RU6 2.05 Å, Crystal structure of Casein Kinase I delta (CK1d) in complex with monophosphorylated p63…
6RU7 2.08 Å, Crystal structure of Casein Kinase I delta (CK1d) in complex with double phosphorylated…
3ZY1 2.15 Å, Crystal structure of the human p63 tetramerization domain
9N54 2.2 Å, Bipartite p63 NLS in complex with Importin Alpha 2
8P9E 2.25 Å, Crystal structure of wild type p63-p73 heterotetramer (tetramerisation domain) in…
7Z73 2.27 Å, Crystal structure of p63 tetramerization domain in complex with darpin 8F1

Browse structure collections

About this viewer

MolViewer shows 3ZY0 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.