3ZY1: Human p63 tetramerization domain
Crystal structure of the human p63 tetramerization domain. Determined by X-ray diffraction at 2.15 Å resolution. Released 30 Nov 2011.
- Method
- X-ray diffraction
- Resolution
- 2.15 Å
- Organism
- HOMO SAPIENS
- Chains
- 1
- Atoms
- 332
- Mol. weight
- 5.6 kDa
- Released
- 30 Nov 2011
Explore 3ZY1 in 3D
Show helices and sheets
RCSB PDB
PDBe
Secondary structure: helices and β-sheets
3ZY1 contains 3 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
Chain A: 3 helices, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 369-383 | 15 | |
| α-helix | 384-387 | 4 | |
| α-helix | 390-397 | 8 | |
Molecules and chains
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|
| Tumor protein 63 | A | protein | 46 | HOMO SAPIENS | Q9H3D4 (AlphaFold model) |
Sequence of entity 1 (A), FASTA
>3ZY1_1 TUMOR PROTEIN 63 (chains A)
GSDELLYLPVRGRETYEMLLKIKESLELMQYLPQHTIETYRQQQQQ
Primary citation
Structure and Kinetic Stability of the P63 Tetramerization Domain. Natan, E., Joerger, A.C. J Mol Biol (2012) 415:503. DOI 10.1016/J.JMB.2011.11.007 · PubMed
Other PDB entries of the same protein (UniProt Q9H3D4 (AlphaFold model), which also has an AlphaFold model), best resolution first:
- 2Y9U 1.6 Å, Structural basis of p63a SAM domain mutants involved in AEC syndrome
- 8P9C 1.76 Å, Crystal structure of p63-p73 heterotetramer (tetramerisation domain) in complex with…
- 7Z72 1.8 Å, Crystal structure of p63 SAM in complex with darpin A5
- 7Z7E 1.8 Å, Crystal structure of p63 DNA binding domain in complex with inhibitory DARPin G4
- 7Z71 1.85 Å, Crystal structure of p63 DBD in complex with darpin C14
- 3ZY0 1.9 Å, Crystal structure of a truncated variant of the human p63 tetramerization domain lacking…
- 6RU8 1.92 Å, Crystal structure of Casein Kinase I delta (CK1d) in complex with triple phosphorylated…
- 6RU6 2.05 Å, Crystal structure of Casein Kinase I delta (CK1d) in complex with monophosphorylated p63…
- 6RU7 2.08 Å, Crystal structure of Casein Kinase I delta (CK1d) in complex with double phosphorylated…
- 9N54 2.2 Å, Bipartite p63 NLS in complex with Importin Alpha 2
- 8P9E 2.25 Å, Crystal structure of wild type p63-p73 heterotetramer (tetramerisation domain) in…
- 7Z73 2.27 Å, Crystal structure of p63 tetramerization domain in complex with darpin 8F1
Browse structure collections
About this viewer
MolViewer shows 3ZY1 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.