4AYM: Complement factor H

Structure of a complex between CCPs 6 and 7 of Human Complement Factor H and Neisseria meningitidis FHbp Variant 3 P106A mutant. Determined by X-ray diffraction at 3.0 Å resolution. Released 7 Nov 2012.

Method: X-ray diffraction
Resolution: 3.0 Å
Organisms: HOMO SAPIENS, NEISSERIA MENINGITIDIS MC58
Chains: 6
Atoms: 7,506
Mol. weight: 116.62 kDa
Released: 7 Nov 2012

Explore 4AYM in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4AYM contains 35 α-helices and 90 β-strands across 6 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A, B, E and F: 5 helices, 13 β-strands

Element	Residues	Length	Sheet
β-strand	333-335	3	1
α-helix	338-341	4
α-helix	342-344	3
β-strand	352-357	6	1
β-strand	361-362	2	2
β-strand	369-375	7	1
β-strand	378-380	3	1
β-strand	386-387	2	2
β-strand	388-390	3	3
α-helix	391-393	3
β-strand	397	1	4
β-strand	405-407	3	3
β-strand	411-413	3	5
β-strand	416	1	4
α-helix	417	1
α-helix	423-425	3
β-strand	428-432	5	5
β-strand	435-437	3	5

Chain C: 7 helices, 19 β-strands

Element	Residues	Length	Sheet
α-helix	88-89	2
β-strand	99	1	11
α-helix	102-104	3
β-strand	110-115	6	12
β-strand	118-123	6	12
β-strand	128	1	11
α-helix	130-132	3
α-helix	134	1
β-strand	138-147	10	12
β-strand	154-165	12	12
β-strand	169-180	12	12
β-strand	188-201	14	12
β-strand	203	1	13
α-helix	204	1
β-strand	205	1	14
α-helix	206-208	3
β-strand	214-223	10	13
β-strand	226-236	11	13
β-strand	241-247	7	13
α-helix	255	1
β-strand	256-265	10	13
β-strand	270	1	14
β-strand	271-279	9	13
β-strand	282-292	11	13
β-strand	298-307	10	13
β-strand	310-319	10	13

Chain D: 8 helices, 19 β-strands

Element	Residues	Length	Sheet
α-helix	82-86	5
α-helix	88-89	2
β-strand	99-100	2	15
α-helix	102-104	3
β-strand	110-115	6	16
β-strand	118-123	6	16
β-strand	127-128	2	15
α-helix	130-132	3
α-helix	134	1
β-strand	138-149	12	16
β-strand	152-165	14	16
β-strand	169-180	12	16
β-strand	188-201	14	16
β-strand	203	1	17
α-helix	204	1
β-strand	205	1	18
α-helix	206-208	3
β-strand	214-223	10	17
β-strand	226-236	11	17
β-strand	241-247	7	17
α-helix	255	1
β-strand	256-265	10	17
β-strand	270	1	18
β-strand	271-278	8	17
β-strand	285-292	8	17
β-strand	298-307	10	17
β-strand	310-319	10	17

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Complement factor H	A, B, E, F	protein	125	HOMO SAPIENS	P08603 (AlphaFold model)
Factor H binding protein	C, D	protein	270	NEISSERIA MENINGITIDIS MC58	Q19KF7 (AlphaFold model)

Sequence of entity 1 (A, B, E, F), FASTA

>4AYM_1 COMPLEMENT FACTOR H (chains A, B, E, F)
MGTLKPCDYPDIKHGGLYHENMRRPYFPVAVGKYYSYYCDEHFETPSGSYWDHIHCTQDG
WSPAVPCLRKCYFPYLENGYNQNHGRKFVQGKSIDVACHPGYALPKAQTTVTCMENGWSP
TPRCI

Sequence of entity 2 (C, D), FASTA

>4AYM_2 FACTOR H BINDING PROTEIN (chains C, D)
MGPDSDRLQQRRVAADIGTGLADALTAPLDHKDKGLKSLTLEDSIAQNGTLTLSAQGAEK
TFKAGDKDNSLNTGKLKNDKISRFDFVQKIEVDGQTITLASGEFQIYKQNHSAVVALQIE
KINNPDKTDSLINQRSFLVSGLGGEHTAFNQLPGGKAEYHGKAFSSDDPNGRLHYSIDFT
KKQGYGRIEHLKTLEQNVELAAAELKADEKSHAVILGDTRYGSEEKGTYHLALFGDRAQE
IAGSATVKIGEKVHEIGIAGKQLEHHHHHH

Primary citation

Design and Evaluation of Meningococcal Vaccines Through Structure-Based Modification of Host and Pathogen Molecules. Johnson, S., Tan, L., Van Der Veen, S. et al. PLoS Pathog (2012) 8:2981. DOI 10.1371/JOURNAL.PPAT.1002981 · PubMed

Other PDB entries of the same protein (UniProt P08603 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4K12 1.08 Å, Structural Basis for Host Specificity of Factor H Binding by Streptococcus pneumoniae
3R62 1.52 Å, Structure of complement regulator Factor H mutant, T1184R.
3KZJ 1.65 Å, Structure of complement Factor H variant R1203A
2G7I 1.75 Å, Structure of Human Complement Factor H Carboxyl Terminal Domains 19-20: a Basis for…
3SW0 1.8 Å, Structure of the C-terminal region (modules 18-20) of complement regulator Factor H
6ATG 1.8 Å, Insights to complement factor H recruitment by the borrelial CspZ protein as revealed by…
9MLU 1.82 Å, FbaA with Factor H 6-7 domain
9MMX 1.9 Å, M6 protein with Factor H 6-7 domain
3KXV 2.0 Å, Structure of complement Factor H variant Q1139A
3OXU 2.1 Å, Complement components factor H CCP19-20 and C3d in complex
4ONT 2.15 Å, Ternary host recognition complex of complement factor H, C3d, and sialic acid
6ZH1 2.2 Å, Crystal structure of complex between FH19-20 and FhbA protein from Borrelia hermsii

Browse structure collections

About this viewer

MolViewer shows 4AYM directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.