4B4C: DNA-binding domain of human CHD1

Crystal structure of the DNA-binding domain of human CHD1. Determined by X-ray diffraction at 1.62 Å resolution. Released 15 Aug 2012.

Method: X-ray diffraction
Resolution: 1.62 Å
Organism: HOMO SAPIENS
Chains: 1
Atoms: 1,726
Mol. weight: 24.33 kDa
Released: 15 Aug 2012

Explore 4B4C in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4B4C contains 9 α-helices and 2 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 9 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	1128-1138	11
α-helix	1144-1146	3
α-helix	1148-1154	7
α-helix	1162-1180	19
β-strand	1201-1204	4	1
β-strand	1207-1210	4	1
α-helix	1211-1227	17
α-helix	1232-1236	5
α-helix	1255-1268	14
α-helix	1273-1278	6
α-helix	1299-1324	26

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Chromodomain-helicase-DNA-binding protein 1	A	protein	211	HOMO SAPIENS	O14646 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>4B4C_1 CHROMODOMAIN-HELICASE-DNA-BINDING PROTEIN 1 (chains A)
SMPRENIKGFSDAEIRRFIKSYKKFGGPLERLDAIARDAELVDKSETDLRRLGELVHNGC
IKALKDSSSGTERTGGRLGKVKGPTFRISGVQVNAKLVISHEEELIPLHKSIPSDPEERK
QYTIPCHTKAAHFDIDWGKEDDSNLLIGIYEYGYGSWEMIKMDPDLSLTHKILPDDPDKK
PQAKQLQTRADYLIKLLSRDLAKKEALSGAG

Primary citation

Crystal Structure of the DNA-Binding Domain of Human Chd1. Allerston, C.K., Cooper, C.D.O., Shrestha, L. et al. To be published.

Other PDB entries of the same protein (UniProt O14646 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9T9F 1.35 Å, Crystal structure of human CHD1 tandem chromodomain in complex with the…
9T9H 1.45 Å, Crystal structure of human CHD1 tandem chromodomain in complex with the…
9T9I 1.55 Å, Crystal structure of human CHD1 tandem chromodomain in complex with the…
5AFW 1.6 Å, Assembly of methylated LSD1 and CHD1 drives AR-dependent transcription and translocation
9T9E 1.7 Å, Crystal structure of human CHD1 tandem chromodomain in complex with the…
9T9G 1.7 Å, Crystal structure of human CHD1 tandem chromodomain in complex with the…
4O42 1.87 Å, Tandem chromodomains of human CHD1 in complex with influenza NS1 C-terminal tail…
4NW2 1.9 Å, Tandem chromodomains of human CHD1 in complex with Influenza virus NS1 C-terminal tail…
2B2Y 2.35 Å, Tandem chromodomains of human CHD1
2B2W 2.4 Å, Tandem chromodomains of human CHD1 complexed with Histone H3 Tail containing…
2B2T 2.45 Å, Tandem chromodomains of human CHD1 complexed with Histone H3 Tail containing…
2B2V 2.65 Å, Crystal structure analysis of human CHD1 chromodomains 1 and 2 bound to histone H3 resi…

Browse structure collections

About this viewer

MolViewer shows 4B4C directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.