4CIK: Plasminogen kringle 1

plasminogen kringle 1 in complex with inhibitor. Determined by X-ray diffraction at 1.78 Å resolution. Released 18 Jun 2014.

Method: X-ray diffraction
Resolution: 1.78 Å
Organism: HOMO SAPIENS
Chains: 1
Atoms: 862
Mol. weight: 9.84 kDa
Ligands: XO3
Released: 18 Jun 2014

Explore 4CIK in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4CIK contains 2 α-helices and 9 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 2 helices, 9 β-strands

Element	Residues	Length	Sheet
β-strand	3	1	1
β-strand	16	1	2
α-helix	21	1
β-strand	22	1	2
β-strand	23	1	3
α-helix	24-25	2
β-strand	52	1	4
β-strand	62-64	3	4
β-strand	65	1	3
β-strand	72-74	3	4
β-strand	79	1	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Plasminogen	A	protein	83	HOMO SAPIENS	P00747 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>4CIK_1 PLASMINOGEN (chains A)
KRSECKTGNGKNYRGTMSKTKNGITCQKWSSTSPHRPRFSPATHPSEGLEENYCRNPDND
PQGPWCYTTDPEKRYDYCDILEC

Ligands and cofactors

ID	Name	Formula	Copies
XO3	5-[(2R,4S)-2-(phenylmethyl)piperidin-4-yl]-1,2-oxazol-3-one	C15 H18 N2 O2	1

Primary citation

Discovery of the Fibrinolysis Inhibitor Azd6564, Acting Via Interference of a Protein-Protein Interaction. Cheng, L., Pettersen, D., Ohlsson, B. et al. ACS Med Chem Lett (2014) 5:538. DOI 10.1021/ML400526D · PubMed

Other PDB entries of the same protein (UniProt P00747 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5UGG 1.2 Å, Protease Inhibitor
6D3Y 1.32 Å, Highly Potent and Selective Plasmin Inhibitors Based on the Sunflower Trypsin…
5UGD 1.38 Å, Protease Inhibitor
6D40 1.43 Å, Highly Potent and Selective Plasmin Inhibitors Based on the Sunflower Trypsin…
8F7U 1.47 Å, Macrocyclic Plasmin Inhibitor
7UAH 1.57 Å, Macrocyclic plasmin inhibitor
8F7V 1.65 Å, Macrocyclic plasmin inhibitor
5HPG 1.66 Å, Structure and ligand determinants of the recombinant kringle 5 domain of human plasminogen
1KRN 1.67 Å, Structure of kringle 4 at 4C temperature and 1.67 Å resolution
6OG4 1.7 Å, plasminogen binding group A streptococcal M protein
1KI0 1.75 Å, The X-ray Structure of Human Angiostatin
6D3X 1.8 Å, Highly Potent and Selective Plasmin Inhibitors Based on the Sunflower Trypsin…

Browse structure collections

About this viewer

MolViewer shows 4CIK directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.