4DB1: Cardiac human myosin S1dC, beta isoform

Cardiac human myosin S1dC, beta isoform complexed with Mn-AMPPNP. Determined by X-ray diffraction at 2.6 Å resolution. Released 25 Jan 2012.

Method: X-ray diffraction
Resolution: 2.6 Å
Organism: Homo sapiens
Chains: 2
Atoms: 11,340
Mol. weight: 179.33 kDa
Ligands: MN, ANP
Released: 25 Jan 2012

Explore 4DB1 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4DB1 contains 75 α-helices and 52 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 38 helices, 26 β-strands

Element	Residues	Length	Sheet
α-helix	4-15	12
α-helix	20-28	9
β-strand	36-40	5	1
β-strand	46-54	9	1
β-strand	58-63	6	1
β-strand	67-72	6	1
α-helix	73-75	3
β-strand	77-78	2	1
α-helix	79-81	3
α-helix	82-84	3
β-strand	89	1	2
α-helix	90-92	3
α-helix	98-110	13
β-strand	115-118	4	2
β-strand	121-125	5	2
α-helix	136-142	7
α-helix	147-149	3
α-helix	154-168	15
β-strand	172-177	6	2
α-helix	184-198	15
β-strand	200	1	3
α-helix	201-203	3
α-helix	216-231	16
β-strand	232-233	2	4
β-strand	241-242	2	4
β-strand	245-252	8	2
β-strand	257	1	3
β-strand	258-266	9	2
α-helix	270-273	4
β-strand	283	1	4
α-helix	284-290	7
α-helix	295-300	6
α-helix	307-309	3
α-helix	311-313	3
α-helix	325-338	14
α-helix	343-359	17
β-strand	364-366	3	5
β-strand	373-375	3	5
α-helix	379-387	9
α-helix	392-400	9
α-helix	417-447	31
β-strand	455-461	7	2
α-helix	473-504	32
α-helix	513-517	5
α-helix	518-525	8
α-helix	530-534	5
α-helix	545-556	12
β-strand	563-564	2	6
α-helix	565-567	3
β-strand	577-581	5	6
β-strand	584-588	5	6
α-helix	593-598	6
α-helix	603-610	8
α-helix	615-622	8
α-helix	647-663	17
β-strand	666-673	8	2
α-helix	686-695	10
α-helix	698-706	9
β-strand	711-714	4	7
α-helix	744-747	4
α-helix	753-755	3
β-strand	756-758	3	7
β-strand	762-765	4	7
α-helix	769-776	8

Chain B: 37 helices, 26 β-strands

Element	Residues	Length	Sheet
α-helix	4-15	12
α-helix	20-28	9
β-strand	36-40	5	8
β-strand	46-54	9	8
β-strand	58-63	6	8
β-strand	68-72	5	8
α-helix	73-75	3
β-strand	77-78	2	8
α-helix	79-81	3
α-helix	82-84	3
β-strand	89	1	9
α-helix	90-92	3
α-helix	98-109	12
β-strand	115-118	4	9
β-strand	121-125	5	9
α-helix	136-142	7
α-helix	147-149	3
α-helix	154-168	15
β-strand	172-178	7	9
α-helix	184-198	15
β-strand	200	1	10
α-helix	201-203	3
α-helix	216-231	16
β-strand	232-233	2	11
β-strand	241-242	2	11
β-strand	245-252	8	9
β-strand	257	1	10
β-strand	258-266	9	9
α-helix	270-273	4
β-strand	283	1	11
α-helix	284-290	7
α-helix	295-301	7
α-helix	307-309	3
α-helix	311-313	3
α-helix	325-338	14
α-helix	343-359	17
β-strand	364-366	3	12
β-strand	373-375	3	12
α-helix	379-387	9
α-helix	392-400	9
α-helix	417-447	31
β-strand	455-461	7	9
α-helix	473-502	30
α-helix	510-512	3
α-helix	513-517	5
α-helix	518-525	8
α-helix	530-538	9
α-helix	545-556	12
β-strand	563-564	2	13
α-helix	573-574	2
β-strand	577-581	5	13
β-strand	584-588	5	13
α-helix	593-598	6
α-helix	603-610	8
α-helix	615-622	8
α-helix	647-662	16
β-strand	666-673	8	9
α-helix	686-696	11
α-helix	702-707	6
β-strand	711-713	3	14
β-strand	756-758	3	14
β-strand	763-765	3	14
α-helix	769-773	5

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Myosin-7	A, B	protein	783	Homo sapiens	P12883 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>4DB1_1 Myosin-7 (chains A, B)
GGDSEMAVFGAAAPYLRKSEKERLEAQTRPFDLKKDVFVPDDKQEFVKAKIVSREGGKVT
AETEYGKTVTVKEDQVMQQNPPKFDKIEDMAMLTFLHEPAVLYNLKDRYGSWMIYTYSGL
FCVTVNPYKWLPVYTPEVVAAYRGKKRSEAPPHIFSISDNAYQYMLTDRENQSILITGES
GAGKTVNTKRVIQYFAVIAAIGDRSKKDQSPGKGTLEDQIIQANPALEAFGNAKTVRNDN
SSRFGKFIRIHFGATGKLASADIETYLLEKSRVIFQLKAERDYHIFYQILSNKKPELLDM
LLITNNPYDYAFISQGETTVASIDDAEELMATDNAFDVLGFTSEEKNSMYKLTGAIMHFG
NMKFKLKQREEQAEPDGTEEADKSAYLMGLNSADLLKGLCHPRVKVGNEYVTKGQNVQQV
IYATGALAKAVYERMFNWMVTRINATLETKQPRQYFIGVLDIAGFEIFDFNSFEQLCINF
TNEKLQQFFNHHMFVLEQEEYKKEGIEWTFIDFGMDLQACIDLIEKPMGIMSILEEECMF
PKATDMTFKAKLFDNHLGKSANFQKPRNIKGKPEAHFSLIHYAGIVDYNIIGWLQKNKDP
LNETVVGLYQKSSLKLLSTLFANYAGADAPIEKGKGKAKKGSSFQTVSALHRENLNKLMT
NLRSTHPHFVRCIIPNETKSPGVMDNPLVMHQLRCNGVLEGIRICRKGFPNRILYGDFRQ
RYRILNPAAIPEGQFIDSRKGAEKLLSSLDIDHNQYKFGHTKVFFKAGLLGLLEEMRDER
LSR

Ligands and cofactors

ID	Name	Formula	Copies
MN	Manganese (II) ion	Mn	2
ANP	Phosphoaminophosphonic acid-adenylate ester	C10 H17 N6 O12 P3	2

Primary citation

Cardiac human myosin S1dC, beta isoform complexed with Mn-AMPPNP. Klenchin, V.A., Deacon, J.C., Combs, A.C. et al. To be published.

Other PDB entries of the same protein (UniProt P12883 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5CJ1 2.1 Å, Crystal structure of the coiled coil of MYH7 residues 1526 to 1571 fused to Gp7
6PF2 2.17 Å, Crystal Structure of Amino Acids 1220-1276 of Human Beta Cardiac Myosin Fused to Gp7 and…
6PFP 2.2 Å, Crystal Structure of Amino Acids 1473-1536 of Human Beta Cardiac Myosin Fused to Gp7 and…
4PA0 2.25 Å, Omecamtiv Mercarbil binding site on the Human Beta-Cardiac Myosin Motor Domain
5CHX 2.3 Å, Crystal Structure of amino acids 1590-1657 of MYH7
5CJ0 2.3 Å, Crystal Structure of Amino Acids 1631-1692 of MYH7
5WME 2.3 Å, Crystal Structure of Amino Acids 1729-1786 of Human Beta Cardiac Myosin Fused to Gp7 as…
4XA4 2.33 Å, Crystal Structure of the coiled-coil surrounding Skip 3 of MYH7
9HTF 2.48 Å, Beta-cardiac myosin Y115H mutant motor domain in the pre-powerstroke state, MgADP.VO4 form
2FXO 2.5 Å, Structure of the human beta-myosin S2 fragment
5WJ7 2.5 Å, Crystal Structure of Amino Acids 1733-1797 of Human Beta Cardiac Myosin Fused to Xrcc4
4XA3 2.55 Å, Crystal structure of the coiled-coil surrounding Skip 2 of MYH7

Browse structure collections

About this viewer

MolViewer shows 4DB1 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.