4DRB: FANCM bound MHF complex

The crystal structure of FANCM bound MHF complex. Determined by X-ray diffraction at 2.63 Å resolution. Released 16 May 2012.

Method: X-ray diffraction
Resolution: 2.63 Å
Organism: Homo sapiens
Chains: 15
Atoms: 10,508
Mol. weight: 192.58 kDa
Released: 16 May 2012

Explore 4DRB in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4DRB contains 74 α-helices and 30 β-strands across 15 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 4 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	15-38	24
β-strand	41-42	2	1
α-helix	44-71	28
β-strand	76-77	2	2
α-helix	79-85	7
α-helix	90-107	18

Chain B: 4 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	6-38	33
β-strand	42	1	3
α-helix	44-71	28
β-strand	76-77	2	4
α-helix	79-84	6
α-helix	90-106	17

Chain C: 6 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	682-691	10
β-strand	702-704	3	5
β-strand	728-730	3	5
α-helix	737-739	3
α-helix	743-745	3
α-helix	753-767	15
α-helix	776-782	7
α-helix	787-789	3

Chain D: 5 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	10-12	3
α-helix	15-37	23
β-strand	41-42	2	6
α-helix	44-71	28
β-strand	76-77	2	7
α-helix	79-85	7
α-helix	90-104	15

Chain E: 5 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	11-38	28
β-strand	42	1	8
α-helix	44-71	28
β-strand	76-77	2	9
α-helix	79-83	5
α-helix	84-86	3
α-helix	90-102	13

Chain F: 8 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	682-691	10
α-helix	693-695	3
β-strand	702-704	3	10
β-strand	728-730	3	10
α-helix	737-739	3
α-helix	743-745	3
α-helix	750-752	3
α-helix	753-766	14
α-helix	776-781	6
α-helix	782-784	3

Chain G: 5 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	5-37	33
β-strand	41-42	2	11
α-helix	44-71	28
β-strand	76-77	2	12
α-helix	79-83	5
α-helix	84-86	3
α-helix	90-106	17

Chain H: 4 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	15-37	23
β-strand	41-42	2	13
α-helix	44-71	28
β-strand	76-77	2	14
α-helix	79-85	7
α-helix	90-105	16

6 more chain groups are not listed. Open the entry in the viewer and use the sequence panel to see them.

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Centromere protein S	A, B, D, E, G, H	protein	120	Homo sapiens	Q8N2Z9 (AlphaFold model)
Fanconi anemia group M protein	C, F, I	protein	141	Homo sapiens	Q8IYD8 (AlphaFold model)
Centromere protein X	J, K, L, M, N, O	protein	84	Homo sapiens	A8MT69 (AlphaFold model)

Sequence of entity 1 (A, B, D, E, G, H), FASTA

>4DRB_1 Centromere protein S (chains A, B, D, E, G, H)
HHHHHHMEEEAETEEQQRFSYQQRLKAAVHYTVGCLCEEVALDKEMQFSKQTIAAISELT
FRQCENFAKDLEMFARHAKRTTINTEDVKLLARRSNSLLKYITDKSEEIAQINLERKAQK

Sequence of entity 2 (C, F, I), FASTA

>4DRB_2 Fanconi anemia group M protein (chains C, F, I)
GSIFSYRDGMRQSSLKKDWFLSEEEFKLWNRLYRLRDSDEIKEITLPQVQFSSLQNEENK
PAQESTTGIHQLSLSEWRLWQDHPLPTHQVDHSDRCRHFIGLMQMIEGMRHEEGECSYEL
EVESYLQMEDVTSTFIAPRNE

Sequence of entity 3 (J, K, L, M, N, O), FASTA

>4DRB_3 Centromere protein X (chains J, K, L, M, N, O)
GSHMEGAGAGSGFRKELVSRLLHLHFKDDKTKVSGDALQLMVELLKVFVVEAAVRGVRQA
QAEDALRVDVDQLEKVLPQLLLDF

Primary citation

The structure of the FANCM-MHF complex reveals physical features for functional assembly. Tao, Y., Jin, C., Li, X. et al. Nat Commun (2012) 3:782-782. DOI 10.1038/ncomms1779 · PubMed

Other PDB entries of the same protein (UniProt Q8N2Z9 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4NE3 1.8 Å, Human MHF1-MHF2 complex
4E45 2.0 Å, Crystal structure of the hMHF1/hMHF2 Histone-Fold Tetramer in Complex with Fanconi…
4E44 2.1 Å, Crystal structure of the hMHF1/hMHF2 Histone-Fold Tetramer
4NE6 2.1 Å, Human MHF1-MHF2 complex
4DRA 2.41 Å, Crystal structure of MHF complex
4NE5 2.5 Å, Human MHF1-MHF2 complex
28OP 2.7 Å, Structure of the human inner kinetochore CCAN and CENP-C bound to DNA
7R5S 2.83 Å, Structure of the human CCAN bound to alpha satellite DNA
7XHO 3.29 Å, Structure of human inner kinetochore CCAN complex
9TAW 3.54 Å, Structure of the human inner kinetochore CCAN bound to DNA
7XHN 3.71 Å, Structure of human inner kinetochore CCAN-DNA complex
9TAX 4.5 Å, Structure of the human inner kinetochore CCAN bound to a mono-CENP-A nucleosome

Browse structure collections

About this viewer

MolViewer shows 4DRB directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.