Crystal structure of yeast DNA polymerase alpha bound to DNA/RNA and dGTP. Determined by X-ray diffraction at 3.1 Å resolution. Released 27 Feb 2013.
Explore 4FYD in 3D Show helices and sheets RCSB PDB PDBe
4FYD contains 80 α-helices and 66 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 352-362 | 11 | 1 |
| β-strand | 365-373 | 9 | 1 |
| β-strand | 379-386 | 8 | 1 |
| β-strand | 390-397 | 8 | 2 |
| α-helix | 403-418 | 16 | |
| β-strand | 425-431 | 7 | 2 |
| β-strand | 442-451 | 10 | 2 |
| α-helix | 461-463 | 3 | |
| β-strand | 471-475 | 5 | 2 |
| α-helix | 481-488 | 8 | |
| β-strand | 496-499 | 4 | 1 |
| β-strand | 503 | 1 | 1 |
| β-strand | 515-519 | 5 | 1 |
| α-helix | 522-524 | 3 | |
| β-strand | 525-527 | 3 | 1 |
| α-helix | 534-535 | 2 | |
| β-strand | 536-548 | 13 | 3 |
| β-strand | 553-567 | 15 | 3 |
| α-helix | 572-574 | 3 | |
| β-strand | 581-586 | 6 | 3 |
| α-helix | 598-605 | 8 | |
| β-strand | 609-612 | 4 | 3 |
| α-helix | 616-630 | 15 | |
| β-strand | 634-637 | 4 | 3 |
| α-helix | 640-644 | 5 | |
| α-helix | 645-654 | 10 | |
| α-helix | 660-663 | 4 | |
| α-helix | 683-690 | 8 | |
| β-strand | 695-698 | 4 | 3 |
| α-helix | 702-707 | 6 | |
| α-helix | 716-724 | 9 | |
| α-helix | 739-742 | 4 | |
| α-helix | 744-767 | 24 | |
| α-helix | 770-781 | 12 | |
| α-helix | 785-790 | 6 | |
| α-helix | 794-806 | 13 | |
| β-strand | 810 | 1 | 2 |
| α-helix | 811-814 | 4 | |
| β-strand | 848 | 1 | 4 |
| α-helix | 849-851 | 3 | |
| β-strand | 854-856 | 3 | 5 |
| β-strand | 860-865 | 6 | 5 |
| α-helix | 868-875 | 8 | |
| β-strand | 884 | 1 | 6 |
| β-strand | 895 | 1 | 6 |
| α-helix | 902-903 | 2 | |
| α-helix | 905-925 | 21 | |
| α-helix | 930-952 | 23 | |
| α-helix | 964-986 | 23 | |
| β-strand | 991-995 | 5 | 5 |
| β-strand | 996 | 1 | 4 |
| β-strand | 999-1003 | 5 | 5 |
| α-helix | 1009-1024 | 16 | |
| β-strand | 1032-1045 | 14 | 5 |
| β-strand | 1048-1056 | 9 | 5 |
| β-strand | 1062-1069 | 8 | 5 |
| α-helix | 1072-1074 | 3 | |
| α-helix | 1080-1093 | 14 | |
| α-helix | 1099-1119 | 21 | |
| α-helix | 1124-1127 | 4 | |
| β-strand | 1129-1132 | 4 | 7 |
| α-helix | 1141-1144 | 4 | |
| α-helix | 1147-1158 | 12 | |
| β-strand | 1167-1172 | 6 | 7 |
| β-strand | 1173 | 1 | 8 |
| α-helix | 1190-1192 | 3 | |
| β-strand | 1193-1195 | 3 | 7 |
| α-helix | 1196-1199 | 4 | |
| α-helix | 1202-1204 | 3 | |
| β-strand | 1208 | 1 | 8 |
| α-helix | 1210-1212 | 3 | |
| α-helix | 1213-1219 | 7 | |
| α-helix | 1220-1226 | 7 | |
| α-helix | 1234-1241 | 8 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 352-362 | 11 | 9 |
| β-strand | 365-373 | 9 | 9 |
| β-strand | 379-386 | 8 | 9 |
| β-strand | 390-397 | 8 | 10 |
| α-helix | 403-418 | 16 | |
| β-strand | 425-431 | 7 | 10 |
| β-strand | 442-451 | 10 | 10 |
| α-helix | 461-463 | 3 | |
| β-strand | 471-475 | 5 | 10 |
| α-helix | 481-488 | 8 | |
| β-strand | 496-499 | 4 | 9 |
| β-strand | 503 | 1 | 9 |
| β-strand | 515-519 | 5 | 9 |
| α-helix | 522-524 | 3 | |
| β-strand | 525-527 | 3 | 9 |
| α-helix | 534-535 | 2 | |
| β-strand | 536-548 | 13 | 11 |
| β-strand | 553-567 | 15 | 11 |
| α-helix | 572-574 | 3 | |
| β-strand | 581-586 | 6 | 11 |
| α-helix | 598-605 | 8 | |
| β-strand | 609-612 | 4 | 11 |
| α-helix | 616-630 | 15 | |
| β-strand | 634-637 | 4 | 11 |
| α-helix | 640-644 | 5 | |
| α-helix | 645-654 | 10 | |
| α-helix | 660-663 | 4 | |
| α-helix | 683-690 | 8 | |
| β-strand | 695-698 | 4 | 11 |
| α-helix | 702-707 | 6 | |
| α-helix | 716-724 | 9 | |
| α-helix | 739-742 | 4 | |
| α-helix | 744-767 | 24 | |
| α-helix | 770-781 | 12 | |
| α-helix | 785-790 | 6 | |
| α-helix | 794-806 | 13 | |
| β-strand | 810 | 1 | 10 |
| α-helix | 811-814 | 4 | |
| β-strand | 848 | 1 | 12 |
| α-helix | 849-851 | 3 | |
| β-strand | 854-856 | 3 | 13 |
| β-strand | 860-865 | 6 | 13 |
| α-helix | 868-875 | 8 | |
| α-helix | 902-903 | 2 | |
| α-helix | 905-925 | 21 | |
| α-helix | 930-952 | 23 | |
| α-helix | 964-986 | 23 | |
| β-strand | 991-995 | 5 | 13 |
| β-strand | 996 | 1 | 12 |
| β-strand | 999-1003 | 5 | 13 |
| α-helix | 1009-1024 | 16 | |
| β-strand | 1032-1045 | 14 | 13 |
| β-strand | 1048-1056 | 9 | 13 |
| β-strand | 1062-1069 | 8 | 13 |
| α-helix | 1072-1074 | 3 | |
| α-helix | 1080-1093 | 14 | |
| α-helix | 1099-1119 | 21 | |
| α-helix | 1124-1127 | 4 | |
| β-strand | 1129-1132 | 4 | 14 |
| α-helix | 1141-1144 | 4 | |
| α-helix | 1147-1158 | 12 | |
| β-strand | 1167-1172 | 6 | 14 |
| β-strand | 1173 | 1 | 15 |
| α-helix | 1190-1192 | 3 | |
| β-strand | 1193-1195 | 3 | 14 |
| α-helix | 1196-1199 | 4 | |
| α-helix | 1202-1204 | 3 | |
| β-strand | 1208 | 1 | 15 |
| α-helix | 1210-1212 | 3 | |
| α-helix | 1213-1219 | 7 | |
| α-helix | 1220-1226 | 7 | |
| α-helix | 1234-1241 | 8 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| DNA polymerase alpha catalytic subunit A | A, B | protein | 910 | Saccharomyces cerevisiae | P13382 (AlphaFold model) |
| DNA (5'-d(*tp*gp*ap*gp*cp*gp*tp*g*tp*gp*tp*ap*cp*cp*cp*cp*tp*gp*cp*cp*cp*gp*cp*cp*g)-3') | C, D | DNA | 25 | ||
| Dna/rna (5'-r(*cp*gp*gp*cp*gp*gp*gp*cp*ap*g)-d(p*gp*g)-3') | E, F | NA-hybrid | 12 |
>4FYD_1 DNA polymerase alpha catalytic subunit A (chains A, B) TDTFQMFWLDYCEVNNTLILFGKVKLKDDNCVSAMVQINGLCRELFFLPREGKTPTDIHE EIIPLLMDKYGLDNIRAKPQKMKYSFELPDIPSESDYLKVLLPYQTPKSSRDTIPSDLSS DTFYHVFGGNSNIFESFVIQNRIMGPCWLDIKGADFNSIAAASHCAVEVSVDKPQNITPT TTKTMPNLRCLSLSIQTLMNPKENKQEIVSITLSAYRNISLDSPIPENIKPDDLCTLVRP PQSTSFPLGLAALAKQKLPGRVRLFNNEKAMLSCFCAMLKVEDPDVIIGHRLQNVYLDVL AHRMHDLNIPTFSSIGRRLRRTWPEKFGRGNSNMNHFFISDICSGRLICDIANEMGQSLT PKCQSWDLSEMYQVTCEKEHKPLDIDYQNPQYQNDVNSMTMALQENITNCMISAEVSYRI QLLTLTKQLTNLAGNAWAQTLGGTRAGRNEYILLHEFSRNGFIVPDKEGNRSRAQKQRQN EENADAPVNSKKAKYQGGLVFEPEKGLHKNYVLVMDFNSLYPSIIQEFNICFTTVDRNKE DIDELPSVPPSEVDQGVLPRLLANLVDRRREVKKVMKTETDPHKRVQCDIRQQALKLTAN SMYGCLGYVNSRFYAKPLAMLVTNKGREILMNTRQLAESMNLLVVYGDTNSVMIDTGCDN YADAIKIGLGFKRLVNERYRLLEIDIDNVFKKLLLHAKKKYAALTVNLDKNGNGTTVLEV KGLDMKRREFCPLSRDVSIHVLNTILSDKDPEEALQEVYDYLEDIRIKVETNNIRIDKYK INMKLSKDPKAYPGGKNMPAVQVALRMRKAGRVVKAGSVITFVITKQDEIDNAADTPALS VAERAHALNEVMIKSNNLIPDPQYYLEKQIFAPVERLLERIDSFNVVRLSEALGLDSKKY FRREGGNNNG
>4FYD_2 DNA (5'-D(*TP*GP*AP*GP*CP*GP*TP*G*TP*GP*TP*AP*CP*CP*CP*CP*TP*GP*CP*CP*CP*GP*CP*CP*G)-3') (chains C, D) TGAGCGTGTGTACCCCTGCCCGCCG
>4FYD_3 DNA/RNA (5'-R(*CP*GP*GP*CP*GP*GP*GP*CP*AP*G)-D(P*GP*G)-3') (chains E, F) CGGCGGGCAGGG
| ID | Name | Formula | Copies |
|---|---|---|---|
| DGT | 2'-deoxyguanosine-5'-triphosphate | C10 H16 N5 O13 P3 | 2 |
Mechanism for priming DNA synthesis by yeast DNA Polymerase alpha. Perera, R.L., Torella, R., Klinge, S. et al. Elife (2013) 2:e00482. DOI 10.7554/eLife.00482 · PubMed
Other PDB entries of the same protein (UniProt P13382 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 4FYD directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.