Crystal structure of MAD2L2/REV7 in complex with a CAMP fragment in a tetragonal crystal. Determined by X-ray diffraction at 2.1 Å resolution. Released 20 Sept 2017.
Explore 5XPT in 3D Show helices and sheets RCSB PDB PDBe
5XPT contains 11 α-helices and 11 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 12-33 | 22 | |
| α-helix | 39-41 | 3 | |
| β-strand | 42-47 | 6 | 1 |
| β-strand | 50-55 | 6 | 1 |
| α-helix | 58-76 | 19 | |
| β-strand | 80-88 | 9 | 2 |
| β-strand | 94-103 | 10 | 2 |
| β-strand | 113 | 1 | 3 |
| α-helix | 116-118 | 3 | |
| α-helix | 119-131 | 13 | |
| α-helix | 133-136 | 4 | |
| α-helix | 138-141 | 4 | |
| β-strand | 145-152 | 8 | 2 |
| α-helix | 153 | 1 | |
| β-strand | 171-173 | 3 | 2 |
| α-helix | 174-175 | 2 | |
| α-helix | 176-179 | 4 | |
| β-strand | 185-193 | 9 | 2 |
| β-strand | 194 | 1 | 3 |
| β-strand | 198-205 | 8 | 2 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 334-336 | 3 | 2 |
| α-helix | 339-342 | 4 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Mitotic spindle assembly checkpoint protein MAD2B | A | protein | 227 | Homo sapiens | Q9UI95 (AlphaFold model) |
| Chromosome alignment-maintaining phosphoprotein 1 | B | protein | 21 | Homo sapiens | Q96JM3 (AlphaFold model) |
>5XPT_1 Mitotic spindle assembly checkpoint protein MAD2B (chains A) MGSSHHHHHHSQDPNSMTTLTRQDLNFGQVVADVLCEFLEVAVHLILYVREVYPVGIFQK RKKYNVPVQMSCHPELNQYIQDTLHCVKPLLEKNDVEKVVVVILDKEHRPVEKFVFEITQ PPLLSISSDSLLSHVEQLLAAFILKISVCDAVLDHNPPGCTFTVLVHTREAATRNMEKIQ VIKDFPWILADEQDVHMHDPRLIPLKTMTSDILKMQLYVEERAHKGS
>5XPT_2 Chromosome alignment-maintaining phosphoprotein 1 (chains B) MSNPSASSGPWKPAKPAPSVS
Dynamic feature of mitotic arrest deficient 2-like protein 2 (MAD2L2) and structural basis for its interaction with chromosome alignment-maintaining phosphoprotein (CAMP). Hara, K., Taharazako, S., Ikeda, M. et al. J Biol Chem (2017) 292:17658-17667. DOI 10.1074/jbc.M117.804237 · PubMed
Other PDB entries of the same protein (UniProt Q9UI95 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 5XPT directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.